Details of the Target
General Information of Target
Target ID | LDTP01839 | |||||
---|---|---|---|---|---|---|
Target Name | Proenkephalin-A (PENK) | |||||
Gene Name | PENK | |||||
Gene ID | 5179 | |||||
Synonyms |
Proenkephalin-A [Cleaved into: Synenkephalin; Met-enkephalin; Opioid growth factor; OGF; PENK(114-133; PENK(143-183; Met-enkephalin-Arg-Gly-Leu; Leu-enkephalin; PENK(237-258; Met-enkephalin-Arg-Phe] |
|||||
3D Structure | ||||||
Sequence |
MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLK
IWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPM EPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEE EVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEA LPSDEEGESYSKEVPEMEKRYGGFMRF |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Opioid neuropeptide precursor family
|
|||||
Subcellular location |
Cytoplasmic vesicle, secretory vesicle, chromaffin granule lumen
|
|||||
Function |
[Met-enkephalin]: Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.; [Leu-enkephalin]: Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.; [Met-enkephalin-Arg-Phe]: Met-enkephalin-Arg-Phe neuropeptide acts as a strong ligand of Mu-type opioid receptor OPRM1. Met-enkephalin-Arg-Phe-binding to OPRM1 in the nucleus accumbens of the brain increases activation of OPRM1, leading to long-term synaptic depression of glutamate release.; [PENK(114-133)]: Increases glutamate release in the striatum and decreases GABA concentration in the striatum.; [PENK(237-258)]: Increases glutamate release in the striatum.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K259(1.27) | LDD0277 | [1] |