Details of the Target

General Information of Target

Target ID LDTP01824
Target Name Myc proto-oncogene protein (MYC)
Gene Name MYC
Gene ID 4609
Synonyms
BHLHE39; Myc proto-oncogene protein; Class E basic helix-loop-helix protein 39; bHLHe39; Proto-oncogene c-Myc; Transcription factor p64
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Target Type
Clinical trial
Target Bioclass
Transcription factor
Subcellular location
Nucleus, nucleoplasm
Function
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release. Positively regulates transcription of HNRNPA1, HNRNPA2 and PTBP1 which in turn regulate splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform.
TTD ID
T85651
Uniprot ID
P01106
DrugMap ID
TTZILNJ
Ensemble ID
ENST00000377970.6
HGNC ID
HGNC:7553
ChEMBL ID
CHEMBL1250348

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C315(3.27)  LDD3339  [1]
Compound 10
 Probe Info  		N.A.  LDD2216  [2]
IPM
 Probe Info  		C300(0.00); C70(0.00)  LDD2156  [3]
TFBX
 Probe Info  		C85(0.00); C315(0.00)  LDD0148  [4]
AOyne
 Probe Info  		11.80  LDD0443  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 CAL-51 C315(1.93)  LDD2288  [1]
 LDCM0023  KB03 COLO 320 C315(2.38)  LDD2720  [1]
 LDCM0024  KB05 NALM-6 C315(3.27)  LDD3339  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Histone deacetylase 2 (HDAC2) Histone deacetylase family Q92769
Histone deacetylase 3 (HDAC3) Histone deacetylase family O15379
DNA replication licensing factor MCM7 (MCM7) MCM family P33993
Caspase-6 (CASP6) Peptidase C14A family P55212
Transformation/transcription domain-associated protein (TRRAP) PI3/PI4-kinase family Q9Y4A5
E3 SUMO-protein ligase PIAS2 (PIAS2) PIAS family O75928
Cyclin-dependent kinase 4 (CDK4) CMGC Ser/Thr protein kinase family P11802
Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK) Ser/Thr protein kinase family O15111
TGF-beta receptor type-2 (TGFBR2) TKL Ser/Thr protein kinase family P37173
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
NAD-dependent protein deacetylase sirtuin-1 (SIRT1) Sirtuin family Q96EB6
NAD-dependent protein deacylase sirtuin-6 (SIRT6) Sirtuin family Q8N6T7
Chromodomain-helicase-DNA-binding protein 4 (CHD4) SNF2/RAD54 helicase family Q14839
E1A-binding protein p400 (EP400) SNF2/RAD54 helicase family Q96L91
Transcription initiation factor IIB (GTF2B) TFIIB family Q00403
116 kDa U5 small nuclear ribonucleoprotein component (EFTUD2) Classic translation factor GTPase family Q15029
DNA topoisomerase 1 (TOP1) Type IB topoisomerase family P11387
E3 ubiquitin-protein ligase TRIP12 (TRIP12) UPL family Q14669
F-box/WD repeat-containing protein 7 (FBXW7) . Q969H0
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
S-phase kinase-associated protein 2 (SKP2) . Q13309
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Endophilin-B1 (SH3GLB1) Endophilin family Q9Y371
Importin subunit alpha-3 (KPNA4) Importin alpha family O00629
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and BTB domain-containing protein 17 (ZBTB17) Krueppel C2H2-type zinc-finger protein family Q13105
Protein max (MAX) MAX family P61244
Transcription factor Sp1 (SP1) Sp1 C2H2-type zinc-finger protein family P08047
Forkhead box protein O3 (FOXO3) . O43524
Nucleolar transcription factor 1 (UBTF) . P17480
Other
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-10 (ATXN10) Ataxin-10 family Q9UBB4
Cholecystokinin (CCK) Gastrin/cholecystokinin family P06307
MIF4G domain-containing protein (MIF4GD) MIF4GD family A9UHW6
Protein Dr1 (DR1) NC2 beta/DR1 family Q01658
Centrosomal protein of 57 kDa (CEP57) Translokin family Q86XR8
Polyubiquitin-C (UBC) Ubiquitin family P0CG48
Large ribosomal subunit protein uL5 (RPL11) Universal ribosomal protein uL5 family P62913
Gelsolin (GSN) Villin/gelsolin family P06396
Axin-1 (AXIN1) . O15169
Bromodomain-containing protein 3 (BRD3) . Q15059
Cell cycle and apoptosis regulator protein 2 (CCAR2) . Q8N163
Chromobox protein homolog 5 (CBX5) . P45973
F-box/WD repeat-containing protein 8 (FBXW8) . Q8N3Y1
General transcription factor 3C polypeptide 3 (GTF3C3) . Q9Y5Q9
Methyl-CpG-binding domain protein 3 (MBD3) . O95983
NF-kappa-B essential modulator (IKBKG) . Q9Y6K9
Paired amphipathic helix protein Sin3b (SIN3B) . O75182
Protein CIP2A (CIP2A) . Q8TCG1
Smad nuclear-interacting protein 1 (SNIP1) . Q8TAD8
Stress-induced-phosphoprotein 1 (STIP1) . P31948
TAR DNA-binding protein 43 (TARDBP) . Q13148
Ubiquilin-1 (UBQLN1) . Q9UMX0

The Drug(s) Related To This Target

Approved
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Acetylsalicylic Acid Small molecular drug DB00945
Doconexent Small molecular drug DB03756
Nadroparin Small molecular drug DB08813
Dimethyl Sulfoxide . DB01093
Phase 2
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Avi-5126 Antisense drug D01VDI
Resten-ng Antisense drug D0M4MG

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
3 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.