Details of the Target
General Information of Target
| Target ID | LDTP01760 | |||||
|---|---|---|---|---|---|---|
| Target Name | Molybdopterin synthase sulfur carrier subunit (MOCS2) | |||||
| Gene Name | MOCS2 | |||||
| Gene ID | 4338 | |||||
| Synonyms |
MOCO1; Molybdopterin synthase sulfur carrier subunit; MOCO1-A; Molybdenum cofactor synthesis protein 2 small subunit; Molybdenum cofactor synthesis protein 2A; MOCS2A; Molybdopterin-synthase small subunit; Sulfur carrier protein MOCS2A
|
|||||
| 3D Structure | ||||||
| Sequence |
MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVR
QEYVELGDQLLVLQPGDEIAVIPPISGG |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
MoaD family, MOCS2A subfamily
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin. {|HAMAP-Rule:MF_03051}.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [1] | |