Details of the Target
General Information of Target
| Target ID | LDTP01753 | |||||
|---|---|---|---|---|---|---|
| Target Name | Dynein axonemal light chain 4 (DNAL4) | |||||
| Gene Name | DNAL4 | |||||
| Gene ID | 10126 | |||||
| Synonyms |
Dynein axonemal light chain 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET
MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Dynein light chain family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, cilium axoneme
|
|||||
| Function | Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0176 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other

