Details of the Target

General Information of Target

Target ID LDTP01738
Target Name Dynein regulatory complex subunit 4 (GAS8)
Gene Name GAS8
Gene ID 2622
Synonyms
DRC4; GAS11; Dynein regulatory complex subunit 4; Growth arrest-specific protein 11; GAS-11; Growth arrest-specific protein 8; GAS-8
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAPKKKGKKGKAKGTPIVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIH
TFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEG
TVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFER
QVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDI
TLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANY
ERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKT
GFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDL
QYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTPT
Target Bioclass
Other
Family
DRC4 family
Subcellular location
Cytoplasm
Function
Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. Plays an important role in the assembly of the N-DRC linker. Plays dual roles at both the primary (or non-motile) cilia to regulate hedgehog signaling and in motile cilia to coordinate cilia movement. Required for proper motile cilia functioning. Positively regulates ciliary smoothened (SMO)-dependent Hedgehog (Hh) signaling pathway by facilitating the trafficking of SMO into the cilium and the stimulation of SMO activity in a GRK2-dependent manner.
Uniprot ID
O95995
Ensemble ID
ENST00000268699.9
HGNC ID
HGNC:4166

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
LNCaP clone FGC SNV: p.A298T .
MDAMB231 SNV: p.E423G .
MOLT4 SNV: p.A440V .
OPM2 SNV: p.V182F .
RVH421 SNV: p.T61I .
SKMEL5 Insertion: p.R203AfsTer5 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C309(11.37)  LDD0209  [1]
IPM
 Probe Info  		N.A.  LDD0147  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 22RV1 C309(4.18)  LDD2243  [3]
 LDCM0023  KB03 Jurkat C309(11.37)  LDD0209  [1]
 LDCM0024  KB05 SH-4 C309(11.99)  LDD3419  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Protein arginine N-methyltransferase 5 (PRMT5) Protein arginine N-methyltransferase family O14744
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
Probable ATP-dependent RNA helicase DDX17 (DDX17) DEAD box helicase family Q92841
Bifunctional polynucleotide phosphatase/kinase (PNKP) DNA 3' phosphatase family Q96T60
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Glutathione S-transferase A4 (GSTA4) Alpha family O15217
NADPH-dependent diflavin oxidoreductase 1 (NDOR1) NADPH-dependent diflavin oxidoreductase NDOR1 family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family Q9UHB4
Tumor necrosis factor alpha-induced protein 3 (TNFAIP3) Peptidase C64 family P21580
Serine/threonine-protein kinase PLK4 (PLK4) Ser/Thr protein kinase family O00444
Tyrosine-protein kinase Yes (YES1) Tyr protein kinase family P07947
GTP-binding protein GEM (GEM) RGK family P55040
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
E3 ubiquitin-protein ligase TRIM41 (TRIM41) TRIM/RBCC family Q8WV44
RalA-binding protein 1 (RALBP1) . Q15311
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
G protein-coupled receptor associated sorting protein 3 (GPRASP3) GPRASP family Q6PI77
RB-associated KRAB zinc finger protein (RBAK) Krueppel C2H2-type zinc-finger protein family Q9NYW8
Zinc finger and BTB domain-containing protein 22 (ZBTB22) Krueppel C2H2-type zinc-finger protein family O15209
Zinc finger and BTB domain-containing protein 39 (ZBTB39) Krueppel C2H2-type zinc-finger protein family O15060
Zinc finger protein 212 (ZNF212) Krueppel C2H2-type zinc-finger protein family Q9UDV6
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 620 (ZNF620) Krueppel C2H2-type zinc-finger protein family Q6ZNG0
Zinc finger protein 629 (ZNF629) Krueppel C2H2-type zinc-finger protein family Q9UEG4
Zinc finger protein 792 (ZNF792) Krueppel C2H2-type zinc-finger protein family Q3KQV3
Transcription factor Sp7 (SP7) Sp1 C2H2-type zinc-finger protein family Q8TDD2
THAP domain-containing protein 1 (THAP1) THAP1 family Q9NVV9
DNA methyltransferase 1-associated protein 1 (DMAP1) . Q9NPF5
Zinc finger and BTB domain-containing protein 26 (ZBTB26) . Q9HCK0
Other
Click To Hide/Show 63 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ARL6ip family Q15041
Beta-crystallin B1 (CRYBB1) Beta/gamma-crystallin family P53674
BLOC-1-related complex subunit 6 (BORCS6) BORCS6 family Q96GS4
Bystin (BYSL) Bystin family Q13895
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Cilia- and flagella-associated protein 53 (CFAP53) CFAP53 family Q96M91
Cyclin-dependent kinase 2-interacting protein (CINP) CINP family Q9BW66
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
Conserved oligomeric Golgi complex subunit 6 (COG6) COG6 family Q9Y2V7
Cancer/testis antigen family 45 member A1 (CT45A1) CT45 family Q5HYN5
Splicing factor YJU2 (YJU2) CWC16 family Q9BW85
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Cyclin-G1 (CCNG1) Cyclin family P51959
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Death domain-associated protein 6 (DAXX) DAXX family Q9UER7
ELL-associated factor 1 (EAF1) EAF family Q96JC9
Elongation factor Ts, mitochondrial (TSFM) EF-Ts family P43897
Probable RNA-binding protein EIF1AD (EIF1AD) EIF1AD family Q8N9N8
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM161B (FAM161B) FAM161 family Q96MY7
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Protein HEXIM2 (HEXIM2) HEXIM family Q96MH2
Homer protein homolog 3 (HOMER3) Homer family Q9NSC5
Keratin, type I cytoskeletal 14 (KRT14) Intermediate filament family P02533
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Liprin-alpha-1 (PPFIA1) Liprin family Q13136
Mitotic spindle assembly checkpoint protein MAD1 (MAD1L1) MAD1 family Q9Y6D9
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
Mitochondria-eating protein (SPATA18) MIEAP family Q8TC71
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
MORF4 family-associated protein 1-like 1 (MRFAP1L1) MORF4 family-associated protein family Q96HT8
Paraneoplastic antigen-like protein 5 (PNMA5) PNMA family Q96PV4
POTE ankyrin domain family member B3 (POTEB3) POTE family A0JP26
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
RAD50-interacting protein 1 (RINT1) RINT1 family Q6NUQ1
Ski-like protein (SKIL) SKI family P12757
Alpha-taxilin (TXLNA) Taxilin family P40222
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
TNF receptor-associated factor 5 (TRAF5) TNF receptor-associated factor family O00463
Breast cancer anti-estrogen resistance protein 3 (BCAR3) . O75815
Caspase recruitment domain-containing protein 10 (CARD10) . Q9BWT7
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 125 (CCDC125) . Q86Z20
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Coiled-coil domain-containing protein 6 (CCDC6) . Q16204
EVI5-like protein (EVI5L) . Q96CN4
Four and a half LIM domains protein 2 (FHL2) . Q14192
GRIP and coiled-coil domain-containing protein 1 (GCC1) . Q96CN9
GRIP1-associated protein 1 (GRIPAP1) . Q4V328
Heat shock factor 2-binding protein (HSF2BP) . O75031
Insulin-like growth factor-binding protein 6 (IGFBP6) . P24592
Lethal(3)malignant brain tumor-like protein 2 (L3MBTL2) . Q969R5
Multiple myeloma tumor-associated protein 2 (MMTAG2) . Q9BU76
Rhombotin-1 (LMO1) . P25800
Run domain Beclin-1-interacting and cysteine-rich domain-containing protein (RUBCN) . Q92622
SH3 and cysteine-rich domain-containing protein 3 (STAC3) . Q96MF2
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Uncharacterized protein NKAPD1 (NKAPD1) . Q6ZUT1
Vinexin (SORBS3) . O60504

References

1 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840