Details of the Target

General Information of Target

Target ID LDTP01737
Target Name Anterior gradient protein 2 homolog (AGR2)
Gene Name AGR2
Gene ID 10551
Synonyms
AG2; Anterior gradient protein 2 homolog; AG-2; hAG-2; HPC8; Secreted cement gland protein XAG-2 homolog
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEE
ALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP
DGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Target Type
Literature-reported
Target Bioclass
Enzyme
Family
AGR family
Subcellular location
Secreted
Function
Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion.
TTD ID
T34352
Uniprot ID
O95994
DrugMap ID
TT9K86S
Ensemble ID
ENST00000419304.7
HGNC ID
HGNC:328

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K34(10.00); K39(8.33)  LDD0277  [1]
Probe 1
 Probe Info  		Y111(56.84); Y124(5.88); Y152(125.91)  LDD3495  [2]
DBIA
 Probe Info  		C81(3.98)  LDD2379  [3]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [4]
ATP probe
 Probe Info  		K70(0.00); K66(0.00); K165(0.00); K88(0.00)  LDD0035  [5]
WYneN
 Probe Info  		N.A.  LDD0021  [6]
IPM
 Probe Info  		N.A.  LDD0147  [7]
NAIA_5
 Probe Info  		N.A.  LDD2223  [8]
HHS-475
 Probe Info  		Y111(1.08); Y63(0.67)  LDD2238  [9]
HHS-482
 Probe Info  		Y111(0.40); Y63(0.21)  LDD2239  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0632  CL-Sc Hep-G2 C81(1.42); C81(1.32); C81(1.12); C81(0.94)  LDD2227  [8]
 LDCM0022  KB02 ICC10 C81(3.98)  LDD2379  [3]
 LDCM0023  KB03 ICC10 C81(13.49)  LDD2796  [3]
 LDCM0024  KB05 ICC13-7 C81(1.28)  LDD3218  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3 beta-hydroxysteroid dehydrogenase type 7 (HSD3B7) 3-beta-HSD family Q9H2F3
DNA-directed RNA polymerases I, II, and III subunit RPABC5 (POLR2L) Archaeal Rpo10/eukaryotic RPB10 RNA polymerase subunit family P62875
ATPase GET3 (GET3) ArsA ATPase family O43681
Formimidoyltransferase-cyclodeaminase (FTCD) Cyclodeaminase/cyclohydrolase family; Formiminotransferase family O95954
Probable palmitoyltransferase ZDHHC24 (ZDHHC24) DHHC palmitoyltransferase family Q6UX98
Eukaryotic translation initiation factor 3 subunit F (EIF3F) EIF-3 subunit F family O00303
Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2) IMPDH/GMPR family P12268
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Serine/threonine-protein kinase 16 (STK16) Ser/Thr protein kinase family O75716
Non-receptor tyrosine-protein kinase TYK2 (TYK2) Tyr protein kinase family P29597
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
tRNA modification GTPase GTPBP3, mitochondrial (GTPBP3) TrmE GTPase family Q969Y2
DDB1- and CUL4-associated factor 11 (DCAF11) . Q8TEB1
Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2) . Q5T7W7
Transporter and channel
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
Chloride intracellular channel protein 3 (CLIC3) Chloride channel CLIC family O95833
Endophilin-B1 (SH3GLB1) Endophilin family Q9Y371
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Nuclear envelope pore membrane protein POM 121 (POM121) POM121 family Q96HA1
Guided entry of tail-anchored proteins factor CAMLG (CAMLG) . P49069
THO complex subunit 1 (THOC1) . Q96FV9
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
Cyclic AMP-responsive element-binding protein 1 (CREB1) BZIP family P16220
Vascular endothelial zinc finger 1 (VEZF1) Krueppel C2H2-type zinc-finger protein family Q14119
POU domain, class 6, transcription factor 2 (POU6F2) POU transcription factor family P78424
High mobility group protein 20A (HMG20A) . Q9NP66
Pogo transposable element with ZNF domain (POGZ) . Q7Z3K3
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-36 receptor antagonist protein (IL36RN) IL-1 family Q9UBH0
Other
Click To Hide/Show 30 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
BLOC-1-related complex subunit 8 (BORCS8) BORCS8 family Q96FH0
Fatty acid-binding protein, intestinal (FABP2) Fatty-acid binding protein (FABP) family P12104
Retinol-binding protein 5 (RBP5) Fatty-acid binding protein (FABP) family P82980
CDKN2AIP N-terminal-like protein (CDKN2AIPNL) CARF family Q96HQ2
Hematopoietic progenitor cell antigen CD34 (CD34) CD34 family P28906
Centrin-3 (CETN3) Centrin family O15182
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Macrosialin (CD68) LAMP family P34810
Nucleoporin-62 C-terminal-like protein (NUP62CL) Nucleoporin NSP1/NUP62 family Q9H1M0
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
U6 snRNA-associated Sm-like protein LSm1 (LSM1) SnRNP Sm proteins family O15116
General transcription factor IIH subunit 5 (GTF2H5) TFB5 family Q6ZYL4
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Complement C3 (C3) . P01024
GA-binding protein subunit beta-1 (GABPB1) . Q06547
Guanylyl cyclase-activating protein 1 (GUCA1A) . P43080
Kelch-like protein 38 (KLHL38) . Q2WGJ6
Mucin-2 (MUC2) . Q02817
Myosin light polypeptide 6 (MYL6) . P60660
Placental protein 13-like (LGALS14) . Q8TCE9
Protein FAM117B (FAM117B) . Q6P1L5
Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2) . Q9UIG4
Retrotransposon Gag-like protein 4 (RTL4) . Q6ZR62
SH2 domain-containing protein 1B (SH2D1B) . O14796
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
5 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
6 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
9 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.