Details of the Target
General Information of Target
| Target ID | LDTP01729 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sphingosine 1-phosphate receptor 4 (S1PR4) | |||||
| Gene Name | S1PR4 | |||||
| Gene ID | 8698 | |||||
| Synonyms |
EDG6; Sphingosine 1-phosphate receptor 4; S1P receptor 4; S1P4; Endothelial differentiation G-protein coupled receptor 6; Sphingosine 1-phosphate receptor Edg-6; S1P receptor Edg-6 |
|||||
| 3D Structure | ||||||
| Sequence |
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS FRGSRSLSFRMREPLSSISSVRSI |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. May be involved in cell migration processes that are specific for lymphocytes.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C337(3.07) | LDD3333 | [1] | |
|
IA-alkyne Probe Info |
 |
C337(2.32) | LDD2182 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C337(1.37) | LDD2187 | [2] |
| LDCM0573 | Fragment11 | Ramos | C337(3.11) | LDD2190 | [2] |
| LDCM0574 | Fragment12 | Ramos | C337(2.18) | LDD2191 | [2] |
| LDCM0575 | Fragment13 | Ramos | C337(3.22) | LDD2192 | [2] |
| LDCM0580 | Fragment21 | Ramos | C337(2.72) | LDD2195 | [2] |
| LDCM0468 | Fragment33 | Ramos | C337(1.84) | LDD2202 | [2] |
| LDCM0022 | KB02 | Ramos | C337(2.32) | LDD2182 | [2] |
| LDCM0023 | KB03 | MOLM-13 | C337(3.31) | LDD2916 | [1] |
| LDCM0024 | KB05 | MOLM-13 | C337(3.07) | LDD3333 | [1] |
References