Details of the Target
General Information of Target
| Target ID | LDTP01716 | |||||
|---|---|---|---|---|---|---|
| Target Name | Chromobox protein homolog 7 (CBX7) | |||||
| Gene Name | CBX7 | |||||
| Gene ID | 23492 | |||||
| Synonyms |
Chromobox protein homolog 7 |
|||||
| 3D Structure | ||||||
| Sequence |
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA EGFFRDRSGKF |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C102, C107(7.74) | LDD1704 | [1] | |
|
DBIA Probe Info |
 |
C102(1.29); C107(1.29) | LDD2171 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0020 | ARS-1620 | HCC44 | C102(1.29); C107(1.29) | LDD2171 | [2] |
| LDCM0022 | KB02 | T cell-activated | C102, C107(7.74) | LDD1704 | [1] |
| LDCM0024 | KB05 | T cell-activated | C102, C107(9.03) | LDD1706 | [1] |
| LDCM0021 | THZ1 | HCT 116 | C102(1.29); C107(1.29) | LDD2173 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
References