Details of the Target
General Information of Target
| Target ID | LDTP01701 | |||||
|---|---|---|---|---|---|---|
| Target Name | Megakaryocyte and platelet inhibitory receptor G6b (MPIG6B) | |||||
| Gene Name | MPIG6B | |||||
| Gene ID | 80739 | |||||
| Synonyms |
C6orf25; G6B; G6B-B; Megakaryocyte and platelet inhibitory receptor G6b; Protein G6b |
|||||
| 3D Structure | ||||||
| Sequence |
MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGR
RPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVL HVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVV V |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Endoplasmic reticulum; Cell membrane
|
|||||
| Function |
Inhibitory receptor that acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production. Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide. This regulation of megakaryocate function as well as platelet production ann activation is done through the inhibition (via the 2 ITIM motifs) of the receptors CLEC1B and GP6:FcRgamma signaling. Appears to operate in a calcium-independent manner.; Isoform B, displayed in this entry, is the only isoform to contain both a transmembrane region and 2 immunoreceptor tyrosine-based inhibitor motifs (ITIMs) and, thus, the only one which probably has a role of inhibitory receptor. Isoform A may be the activating counterpart of isoform B.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C53(1.56) | LDD2324 | [1] | |
Competitor(s) Related to This Target