Details of the Target
General Information of Target
Target ID | LDTP01695 | |||||
---|---|---|---|---|---|---|
Target Name | Tetraspanin-15 (TSPAN15) | |||||
Gene Name | TSPAN15 | |||||
Gene ID | 23555 | |||||
Synonyms |
NET7; TM4SF15; Tetraspanin-15; Tspan-15; Tetraspan NET-7; Transmembrane 4 superfamily member 15 |
|||||
3D Structure | ||||||
Sequence |
MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFL
APAIILILLGVVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQT IDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACG VPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCTNAVIIWFMDNYTIMAGILLG ILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Tetraspanin (TM4SF) family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Part of TspanC8 subgroup, composed of 6 members that interact with the transmembrane metalloprotease ADAM10. This interaction is required for ADAM10 exit from the endoplasmic reticulum and for enzymatic maturation and trafficking to the cell surface as well as substrate specificity. Different TspanC8/ADAM10 complexes have distinct substrates. Promotes ADAM10-mediated cleavage of CDH2. Negatively regulates ligand-induced Notch activity probably by regulating ADAM10 activity.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
AOyne Probe Info |
![]() |
13.50 | LDD0443 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10) | . | O14672 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF (STRIT1) | . | P0DN84 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Glycophorin-C (GYPC) | Glycophorin-C family | P04921 | |||
Nesprin-4 (SYNE4) | Nesprin family | Q8N205 |