Details of the Target
General Information of Target
| Target ID | LDTP01693 | |||||
|---|---|---|---|---|---|---|
| Target Name | Guanylyl cyclase-activating protein 3 (GUCA1C) | |||||
| Gene Name | GUCA1C | |||||
| Gene ID | 9626 | |||||
| Synonyms |
GCAP3; Guanylyl cyclase-activating protein 3; GCAP 3; Guanylate cyclase activator 1C |
|||||
| 3D Structure | ||||||
| Sequence |
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQV
YNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAV QALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLR VICNGKQPDMETDSSKSPDKAGLGKVKMK |
|||||
| Target Bioclass |
Other
|
|||||
| Function |
Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of guanylyl cyclase (GC) is a key event in recovery of the dark state of rod photoreceptors following light exposure.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C183(0.88) | LDD3370 | [1] | |
Competitor(s) Related to This Target

