Details of the Target
General Information of Target
| Target ID | LDTP01681 | |||||
|---|---|---|---|---|---|---|
| Target Name | Caveolae-associated protein 2 (CAVIN2) | |||||
| Gene Name | CAVIN2 | |||||
| Gene ID | 8436 | |||||
| Synonyms |
SDPR; Caveolae-associated protein 2; Cavin-2; PS-p68; Phosphatidylserine-binding protein; Serum deprivation-response protein |
|||||
| 3D Structure | ||||||
| Sequence |
MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLT
LLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRK VSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAV EGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVD SLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRK KVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKAT SRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQ VHQTS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CAVIN family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae. Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells. May play a role in targeting PRKCA to caveolae.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K102(0.60); K113(10.00); K140(5.15); K238(10.00) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C136(2.08) | LDD3314 | [2] | |
|
BTD Probe Info |
![]() |
C136(0.61) | LDD2109 | [3] | |
|
IPM Probe Info |
![]() |
C136(0.98) | LDD1701 | [3] | |
|
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C136(0.77) | LDD1702 | [3] |
| LDCM0022 | KB02 | A-172 | C136(2.45) | LDD2251 | [2] |
| LDCM0023 | KB03 | MDA-MB-231 | C136(0.98) | LDD1701 | [3] |
| LDCM0024 | KB05 | IGR37 | C136(2.08) | LDD3314 | [2] |
| LDCM0516 | Nucleophilic fragment 21a | MDA-MB-231 | C136(0.61) | LDD2109 | [3] |
| LDCM0530 | Nucleophilic fragment 28a | MDA-MB-231 | C136(0.61) | LDD2123 | [3] |
| LDCM0532 | Nucleophilic fragment 29a | MDA-MB-231 | C136(0.73) | LDD2125 | [3] |
| LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C136(0.87) | LDD2136 | [3] |
| LDCM0546 | Nucleophilic fragment 40 | MDA-MB-231 | C136(0.69) | LDD2140 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Caveolin-1 (CAV1) | Caveolin family | Q03135 | |||
| Pleckstrin homology domain-containing family F member 1 (PLEKHF1) | . | Q96S99 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Caveolae-associated protein 1 (CAVIN1) | CAVIN family | Q6NZI2 | |||
| Microspherule protein 1 (MCRS1) | . | Q96EZ8 | |||
| Pleckstrin (PLEK) | . | P08567 | |||
References





