Details of the Target

General Information of Target

Target ID LDTP01667
Target Name Protein LDOC1 (LDOC1)
Gene Name LDOC1
Gene ID 23641
Synonyms
BCUR1; Protein LDOC1; Leucine zipper protein down-regulated in cancer cells
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGE
SSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRA
FLDEMKQCFGWDDDEDDDDEEEEDDY
Target Bioclass
Other
Family
LDOC1 family
Subcellular location
Nucleus
Function May have an important role in the development and/or progression of some cancers.
Uniprot ID
O95751
Ensemble ID
ENST00000370526.5
HGNC ID
HGNC:6548

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C35(3.45)  LDD3352  [1]
BTD
 Probe Info  		C35(0.91)  LDD2099  [2]
IPM
 Probe Info  		C35(1.99)  LDD1701  [2]
TFBX
 Probe Info  		N.A.  LDD0027  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C35(0.81)  LDD2117  [2]
 LDCM0022  KB02 NCI-H1975 C35(2.53)  LDD2518  [1]
 LDCM0023  KB03 MDA-MB-231 C35(1.99)  LDD1701  [2]
 LDCM0024  KB05 NCI-H1975 C35(3.45)  LDD3352  [1]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C35(0.91)  LDD2099  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone deacetylase 4 (HDAC4) Histone deacetylase family P56524
Ribonuclease P protein subunit p25 (RPP25) Histone-like Alba family Q9BUL9
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Ras-related protein Rab-7L1 (RAB29) Rab family O14966
Guanine nucleotide-binding protein-like 3-like protein (GNL3L) TRAFAC class YlqF/YawG GTPase family Q9NVN8
BRCA1-associated RING domain protein 1 (BARD1) . Q99728
RalA-binding protein 1 (RALBP1) . Q15311
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-1 complex subunit mu-1 (AP1M1) Adaptor complexes medium subunit family Q9BXS5
Huntingtin (HTT) Huntingtin family P42858
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
V-type proton ATPase subunit G 1 (ATP6V1G1) V-ATPase G subunit family O75348
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 21 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-B5 (HOXB5) Antp homeobox family P09067
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Cyclic AMP-dependent transcription factor ATF-4 (ATF4) BZIP family P18848
Fos-related antigen 1 (FOSL1) BZIP family P15407
Cell division cycle 5-like protein (CDC5L) CEF1 family Q99459
Zinc finger and BTB domain-containing protein 16 (ZBTB16) Krueppel C2H2-type zinc-finger protein family Q05516
Zinc finger and BTB domain-containing protein 24 (ZBTB24) Krueppel C2H2-type zinc-finger protein family O43167
Zinc finger protein 1 homolog (ZFP1) Krueppel C2H2-type zinc-finger protein family Q6P2D0
Zinc finger protein 124 (ZNF124) Krueppel C2H2-type zinc-finger protein family Q15973
Zinc finger protein 564 (ZNF564) Krueppel C2H2-type zinc-finger protein family Q8TBZ8
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 629 (ZNF629) Krueppel C2H2-type zinc-finger protein family Q9UEG4
Zinc finger protein 648 (ZNF648) Krueppel C2H2-type zinc-finger protein family Q5T619
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Zinc finger protein 835 (ZNF835) Krueppel C2H2-type zinc-finger protein family Q9Y2P0
Mesogenin-1 (MSGN1) . A6NI15
THAP domain-containing protein 7 (THAP7) . Q9BT49
Transcriptional enhancer factor TEF-3 (TEAD4) . Q15561
Upstream-binding factor 1-like protein 1 (UBTFL1) . P0CB47
Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) . Q8N5A5
Zinc finger protein 408 (ZNF408) . Q9H9D4
Other
Click To Hide/Show 40 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein BEX2 (BEX2) BEX family Q9BXY8
Bystin (BYSL) Bystin family Q13895
Cilia- and flagella-associated protein 53 (CFAP53) CFAP53 family Q96M91
Chromatin modification-related protein MEAF6 (MEAF6) EAF6 family Q9HAF1
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM50B (FAM50B) FAM50 family Q9Y247
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
RNA-binding protein FXR2 (FXR2) FMR1 family P51116
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Proteasome inhibitor PI31 subunit (PSMF1) Proteasome inhibitor PI31 family Q92530
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
Zinc finger protein ubi-d4 (DPF2) Requiem/DPF family Q92785
RIB43A-like with coiled-coils protein 1 (RIBC1) RIB43A family Q8N443
Sin3 histone deacetylase corepressor complex component SDS3 (SUDS3) SDS3 family Q9H7L9
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Translin-associated protein X (TSNAX) Translin family Q99598
Troponin T, slow skeletal muscle (TNNT1) Troponin T family P13805
U3 small nucleolar RNA-associated protein 14 homolog A (UTP14A) UTP14 family Q9BVJ6
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Actin-binding LIM protein 1 (ABLIM1) . O14639
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Beta-catenin-like protein 1 (CTNNBL1) . Q8WYA6
Developmental pluripotency-associated protein 4 (DPPA4) . Q7L190
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
G patch domain and ankyrin repeat-containing protein 1 (GPANK1) . O95872
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Nuclear receptor-interacting protein 1 (NRIP1) . P48552
Phostensin (PPP1R18) . Q6NYC8
Pleckstrin homology domain-containing family F member 2 (PLEKHF2) . Q9H8W4
Ras association domain-containing protein 10 (RASSF10) . A6NK89
Retrotransposon-derived protein PEG10 (PEG10) . Q86TG7
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
TBC1 domain family member 7 (TBC1D7) . Q9P0N9
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Tetratricopeptide repeat protein 23 (TTC23) . Q5W5X9

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255