Details of the Target
General Information of Target
| Target ID | LDTP01658 | |||||
|---|---|---|---|---|---|---|
| Target Name | C-X-C motif chemokine 14 (CXCL14) |
|
||||
| Gene Name | CXCL14 | |||||
| Gene ID | 9547 | |||||
| Synonyms |
MIP2G; NJAC; SCYB14; C-X-C motif chemokine 14; Chemokine BRAK; MIP-2G; Small-inducible cytokine B14 |
|||||
| 3D Structure | ||||||
| Sequence |
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Intercrine alpha (chemokine CxC) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C84(3.62); C63(2.76) | LDD2268 | [1] | |
Competitor(s) Related to This Target