Details of the Target

General Information of Target

Target ID LDTP01651
Target Name Keratin, type II cytoskeletal 75 (KRT75)
Gene Name KRT75
Gene ID 9119
Synonyms
K6HF; KB18; Keratin, type II cytoskeletal 75; Cytokeratin-75; CK-75; Keratin-6 hair follicle; hK6hf; Keratin-75; K75; Type II keratin-K6hf; Type-II keratin Kb18
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSAGASFGSR
SLYNLGGAKRVSINGCGSSCRSGFGGRASNRFGVNSGFGYGGGVGGGFSGPSFPVCPPGG
IQEVTVNQSLLTPLHLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETK
WALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVRYE
DEINKRTAAENEFVALKKDVDAAYMNKVELEAKVKSLPEEINFIHSVFDAELSQLQTQVG
DTSVVLSMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDL
RNTKQEISEMNRMIQRLRAEIDSVKKQCSSLQTAIADAEQRGELALKDARAKLVDLEEAL
QKAKQDMARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTLS
SGYGSGSSIGGGNLGLGGGSGYSFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVS
TTSSSQKSYTH
Target Bioclass
Other
Family
Intermediate filament family
Function Plays a central role in hair and nail formation. Essential component of keratin intermediate filaments in the companion layer of the hair follicle.
Uniprot ID
O95678
Ensemble ID
ENST00000252245.6
HGNC ID
HGNC:24431

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AZ-9
 Probe Info  		E328(0.96); D165(0.99); E171(0.98); D329(1.13)  LDD2208  [1]
OPA-S-S-alkyne
 Probe Info  		K245(4.23); K407(5.23); K166(7.83); K424(12.85)  LDD3494  [2]
DBIA
 Probe Info  		C388(1.02)  LDD3314  [3]
TFBX
 Probe Info  		N.A.  LDD0148  [4]
HHS-465
 Probe Info  		N.A.  LDD2240  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 Daoy C388(2.08)  LDD2314  [3]
 LDCM0023  KB03 Daoy C388(1.61)  LDD2731  [3]
 LDCM0024  KB05 IGR37 C388(1.02)  LDD3314  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
ATP-dependent RNA helicase DHX15 (DHX15) DEAD box helicase family O43143
DNA-directed RNA polymerase III subunit RPC3 (POLR3C) Eukaryotic RPC3/POLR3C RNA polymerase subunit family Q9BUI4
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Nucleoside diphosphate kinase homolog 7 (NME7) NDK family Q9Y5B8
Cleavage and polyadenylation specificity factor subunit 5 (NUDT21) Nudix hydrolase family O43809
Xaa-Arg dipeptidase (PM20D2) Peptidase M20A family Q8IYS1
Testis-specific serine/threonine-protein kinase 3 (TSSK3) CAMK Ser/Thr protein kinase family Q96PN8
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Tumor susceptibility gene 101 protein (TSG101) Ubiquitin-conjugating enzyme family Q99816
F-box only protein 17 (FBXO17) . Q96EF6
Germ cell-less protein-like 1 (GMCL1) . Q96IK5
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) . Q8N7C3
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
WASH complex subunit 3 (WASHC3) CCDC53 family Q9Y3C0
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Exportin-T (XPOT) Exportin family O43592
Nuclear pore glycoprotein p62 (NUP62) Nucleoporin NSP1/NUP62 family P37198
Sodium channel modifier 1 (SCNM1) . Q9BWG6
TBC1 domain family member 1 (TBC1D1) . Q86TI0
Transportin-3 (TNPO3) . Q9Y5L0
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
DNA methyltransferase 1-associated protein 1 (DMAP1) . Q9NPF5
Other
Click To Hide/Show 74 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ankyrin repeat and SOCS box protein 15 (ASB15) Ankyrin SOCS box (ASB) family Q8WXK1
Protein BEX2 (BEX2) BEX family Q9BXY8
Cyclin-dependent kinase 4 inhibitor D (CDKN2D) CDKN2 cyclin-dependent kinase inhibitor family P55273
Cilia- and flagella-associated protein 206 (CFAP206) CFAP206 family Q8IYR0
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
Dysbindin (DTNBP1) Dysbindin family Q96EV8
EF-hand calcium-binding domain-containing protein 4B (CRACR2A) EFCAB4 family Q9BSW2
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
Radial spoke head 14 homolog (RSPH14) Flagellar radial spoke RSP14 family Q9UHP6
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Protein INCA1 (INCA1) INCA family Q0VD86
Desmin (DES) Intermediate filament family P17661
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cuticular Ha7 (KRT37) Intermediate filament family O76014
Keratin, type I cuticular Ha8 (KRT38) Intermediate filament family O76015
Keratin, type I cytoskeletal 13 (KRT13) Intermediate filament family P13646
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
Keratin, type I cytoskeletal 20 (KRT20) Intermediate filament family P35900
Keratin, type I cytoskeletal 24 (KRT24) Intermediate filament family Q2M2I5
Keratin, type I cytoskeletal 25 (KRT25) Intermediate filament family Q7Z3Z0
Keratin, type I cytoskeletal 26 (KRT26) Intermediate filament family Q7Z3Y9
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin, type II cytoskeletal 2 oral (KRT76) Intermediate filament family Q01546
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Peripherin (PRPH) Intermediate filament family P41219
Vimentin (VIM) Intermediate filament family P08670
Lebercilin-like protein (LCA5L) LCA5 family O95447
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Protein Mis18-beta (OIP5) Mis18 family O43482
Meiosis-specific nuclear structural protein 1 (MNS1) MNS1 family Q8NEH6
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
Kinetochore protein NDC80 homolog (NDC80) NDC80/HEC1 family O14777
Neurochondrin (NCDN) Neurochondrin family Q9UBB6
Oxidative stress-induced growth inhibitor 1 (OSGIN1) OKL38 family Q9UJX0
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Spectrin alpha chain, erythrocytic 1 (SPTA1) Spectrin family P02549
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Splicing factor U2AF 35 kDa subunit (U2AF1) Splicing factor SR family Q01081
Suppressor of fused homolog (SUFU) SUFU family Q9UMX1
Syntaxin-11 (STX11) Syntaxin family O75558
Alpha-taxilin (TXLNA) Taxilin family P40222
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
Tektin-1 (TEKT1) Tektin family Q969V4
Tektin-4 (TEKT4) Tektin family Q8WW24
UPF0449 protein C19orf25 (C19orf25) UPF0449 family Q9UFG5
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Caspase recruitment domain-containing protein 10 (CARD10) . Q9BWT7
Cation channel sperm-associated targeting subunit tau (C2CD6) . Q53TS8
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
EPM2A-interacting protein 1 (EPM2AIP1) . Q7L775
G patch domain and ankyrin repeat-containing protein 1 (GPANK1) . O95872
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Heterogeneous nuclear ribonucleoprotein F (HNRNPF) . P52597
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
LIM domain transcription factor LMO4 (LMO4) . P61968
Puratrophin-1 (PLEKHG4) . Q58EX7
Rhombotin-1 (LMO1) . P25800
Sperm-associated antigen 5 (SPAG5) . Q96R06
Tight junction-associated protein 1 (TJAP1) . Q5JTD0
TNF receptor-associated factor 1 (TRAF1) . Q13077
Uncharacterized protein CCDC197 (CCDC197) . Q8NCU1
ZW10 interactor (ZWINT) . O95229

References

1 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
2 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010