Details of the Target
General Information of Target
| Target ID | LDTP01612 | |||||
|---|---|---|---|---|---|---|
| Target Name | Neuroendocrine secretory protein 55 (GNAS) | |||||
| Gene Name | GNAS | |||||
| Gene ID | 2778 | |||||
| Synonyms |
GNAS1; Neuroendocrine secretory protein 55; NESP55) [Cleaved into: LHAL tetrapeptide; GPIPIRRH peptide] |
|||||
| 3D Structure | ||||||
| Sequence |
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIE SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPP STQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPI PIRRH |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
NESP55 family
|
|||||
| Subcellular location |
Cytoplasmic vesicle, secretory vesicle
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HT115 | SNV: p.R218C | . | |||
| KARPAS422 | SNV: p.E140K | DBIA Probe Info | |||
| MEWO | Substitution: p.G238K | DBIA Probe Info | |||
| SW1271 | SNV: p.S207Ter | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C443(2.06) | LDD3310 | [1] | |
Competitor(s) Related to This Target