Details of the Target
General Information of Target
| Target ID | LDTP01554 | |||||
|---|---|---|---|---|---|---|
| Target Name | Laforin (EPM2A) | |||||
| Gene Name | EPM2A | |||||
| Gene ID | 7957 | |||||
| Synonyms |
Laforin; EC 3.1.3.-; EC 3.1.3.16; EC 3.1.3.48; Glucan phosphatase; Glycogen phosphatase; Lafora PTPase; LAFPTPase |
|||||
| 3D Structure | ||||||
| Sequence |
MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLW
LGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDG VYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL KHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEG RVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKR PAVYIDEEALARAQEDFFQKFGKVRSSVCSL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein-tyrosine phosphatase family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Plays an important role in preventing glycogen hyperphosphorylation and the formation of insoluble aggregates, via its activity as glycogen phosphatase, and by promoting the ubiquitination of proteins involved in glycogen metabolism via its interaction with the E3 ubiquitin ligase NHLRC1/malin. Shows strong phosphatase activity towards complex carbohydrates in vitro, avoiding glycogen hyperphosphorylation which is associated with reduced branching and formation of insoluble aggregates. Dephosphorylates phosphotyrosine and synthetic substrates, such as para-nitrophenylphosphate (pNPP), and has low activity with phosphoserine and phosphothreonine substrates (in vitro). Has been shown to dephosphorylate MAPT. Forms a complex with NHLRC1/malin and HSP70, which suppresses the cellular toxicity of misfolded proteins by promoting their degradation through the ubiquitin-proteasome system (UPS). Acts as a scaffold protein to facilitate PPP1R3C/PTG ubiquitination by NHLRC1/malin. Also promotes proteasome-independent protein degradation through the macroautophagy pathway.; [Isoform 2]: Does not bind to glycogen. Lacks phosphatase activity and might function as a dominant-negative regulator for the phosphatase activity of isoform 1 and isoform 7.; [Isoform 7]: Has phosphatase activity (in vitro).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0167 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase NHLRC1 (NHLRC1) | . | Q6VVB1 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Endophilin-B1 (SH3GLB1) | Endophilin family | Q9Y371 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cholecystokinin (CCK) | Gastrin/cholecystokinin family | P06307 | |||
| Protein phosphatase 1 regulatory subunit 3C (PPP1R3C) | . | Q9UQK1 | |||

