Details of the Target

General Information of Target

Target ID LDTP01512
Target Name Gamma-aminobutyric acid receptor-associated protein (GABARAP)
Gene Name GABARAP
Gene ID 11337
Synonyms
FLC3B; Gamma-aminobutyric acid receptor-associated protein; GABA(A) receptor-associated protein; MM46
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Target Bioclass
Transporter and channel
Family
ATG8 family
Subcellular location
Cytoplasmic vesicle, autophagosome membrane
Function
Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in autophagy: while LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover. Also required for the local activation of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, regulating ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) that activates RAC1 and downstream signal transduction. Thereby, regulates different biological processes including the organization of the cytoskeleton, cell migration and proliferation. Involved in apoptosis.
Uniprot ID
O95166
Ensemble ID
ENST00000302386.10
HGNC ID
HGNC:4067
ChEMBL ID
CHEMBL4879423

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y25(20.00)  LDD0257  [1]
TH216
 Probe Info  		Y25(20.00)  LDD0259  [1]
STPyne
 Probe Info  		K24(10.00); K46(9.58); K47(10.00)  LDD0277  [2]
Probe 1
 Probe Info  		Y25(17.92)  LDD3495  [3]
HHS-475
 Probe Info  		Y25(0.70)  LDD0264  [4]
HHS-465
 Probe Info  		Y25(10.00)  LDD2237  [5]
ATP probe
 Probe Info  		N.A.  LDD0199  [6]
1d-yne
 Probe Info  		N.A.  LDD0356  [7]
HHS-482
 Probe Info  		Y25(1.38)  LDD2239  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0116  HHS-0101 DM93 Y25(0.70)  LDD0264  [4]
 LDCM0117  HHS-0201 DM93 Y25(0.68)  LDD0265  [4]
 LDCM0118  HHS-0301 DM93 Y25(0.76)  LDD0266  [4]
 LDCM0119  HHS-0401 DM93 Y25(0.76)  LDD0267  [4]
 LDCM0120  HHS-0701 DM93 Y25(0.66)  LDD0268  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin-like-conjugating enzyme ATG3 (ATG3) ATG3 family Q9NT62
Probable ATP-dependent RNA helicase DDX47 (DDX47) DEAD box helicase family Q9H0S4
Trifunctional enzyme subunit alpha, mitochondrial (HADHA) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family P40939
Serine/threonine-protein kinase Nek9 (NEK9) NEK Ser/Thr protein kinase family Q8TD19
Serine/threonine-protein kinase 3 (STK3) STE Ser/Thr protein kinase family Q13188
Serine/threonine-protein kinase 4 (STK4) STE Ser/Thr protein kinase family Q13043
Ubiquitin-like modifier-activating enzyme 5 (UBA5) Ubiquitin-activating E1 family Q9GZZ9
E3 ubiquitin-protein ligase MIB1 (MIB1) . Q86YT6
E3 ubiquitin-protein ligase NEDD4 (NEDD4) . P46934
Transporter and channel
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Autophagy-related protein 13 (ATG13) ATG13 family O75143
Autophagy-related protein 2 homolog A (ATG2A) ATG2 family Q2TAZ0
Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) ATG7 family O95352
Calreticulin (CALR) Calreticulin family P27797
Importin-5 (IPO5) Importin beta family O00410
Nuclear receptor coactivator 7 (NCOA7) OXR1 family Q8NI08
Pericentriolar material 1 protein (PCM1) PCM1 family Q15154
Cysteine protease ATG4B (ATG4B) Peptidase C54 family Q9Y4P1
FYVE and coiled-coil domain-containing protein 1 (FYCO1) . Q9BQS8
Starch-binding domain-containing protein 1 (STBD1) . O95210
Other
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Autophagy protein 5 (ATG5) ATG5 family Q9H1Y0
Formin-binding protein 1 (FNBP1) FNBP1 family Q96RU3
Folliculin-interacting protein 1 (FNIP1) FNIP family Q8TF40
Protein NipSnap homolog 2 (NIPSNAP2) NipSnap family O75323
Pre-rRNA-processing protein TSR2 homolog (TSR2) TSR2 family Q969E8
Tectonin beta-propeller repeat-containing protein 2 (TECPR2) WD repeat KIAA0329 family O15040
Dynein axonemal assembly factor 4 (DNAAF4) . Q8WXU2
Kelch repeat and BTB domain-containing protein 6 (KBTBD6) . Q86V97
Kelch repeat and BTB domain-containing protein 7 (KBTBD7) . Q8WVZ9
Next to BRCA1 gene 1 protein (NBR1) . Q14596
Pleckstrin homology domain-containing family M member 1 (PLEKHM1) . Q9Y4G2
Protein FAN (NSMAF) . Q92636
Ras association domain-containing protein 1 (RASSF1) . Q9NS23
Ras association domain-containing protein 5 (RASSF5) . Q8WWW0
Sequestosome-1 (SQSTM1) . Q13501
TBC1 domain family member 15 (TBC1D15) . Q8TC07
TBC1 domain family member 2B (TBC1D2B) . Q9UPU7
Tumor protein p53-inducible nuclear protein 1 (TP53INP1) . Q96A56

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
5 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
6 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
7 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.