Details of the Target
General Information of Target
| Target ID | LDTP01506 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tumor necrosis factor ligand superfamily member 15 (TNFSF15) | |||||
| Gene Name | TNFSF15 | |||||
| Gene ID | 9966 | |||||
| Synonyms |
TL1; VEGI; Tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor) [Cleaved into: Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily member 15, secreted form]
|
|||||
| 3D Structure | ||||||
| Sequence |
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK EDKTFFGAFLL |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Tumor necrosis factor family
|
|||||
| Subcellular location |
Secreted; Membrane
|
|||||
| Function | Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C85(0.82) | LDD3342 | [1] | |
Competitor(s) Related to This Target