Details of the Target
General Information of Target
| Target ID | LDTP01391 | |||||
|---|---|---|---|---|---|---|
| Target Name | Gamma-synuclein (SNCG) |
|
||||
| Gene Name | SNCG | |||||
| Gene ID | 6623 | |||||
| Synonyms |
BCSG1; PERSYN; PRSN; Gamma-synuclein; Breast cancer-specific gene 1 protein; Persyn; Synoretin; SR |
|||||
| 3D Structure | ||||||
| Sequence |
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTK
EQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE EAQSGGD |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Synuclein family
|
|||||
| Subcellular location |
Cytoplasm, perinuclear region
|
|||||
| Function |
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K6(6.91) | LDD0277 | [1] | |
The Interaction Atlas With This Target