Details of the Target
General Information of Target
| Target ID | LDTP01342 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tumor suppressor candidate 2 (TUSC2) | |||||
| Gene Name | TUSC2 | |||||
| Gene ID | 11334 | |||||
| Synonyms |
C3orf11; FUS1; LGCC; PDAP2; Tumor suppressor candidate 2; Fusion 1 protein; Fus-1 protein; PDGFA-associated protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA
HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TUSC2 family
|
|||||
| Function | May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K93(10.00) | LDD0277 | [1] | |