Details of the Target
General Information of Target
| Target ID | LDTP01326 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uroplakin-1b (UPK1B) | |||||
| Gene Name | UPK1B | |||||
| Gene ID | 7348 | |||||
| Synonyms |
TSPAN20; Uroplakin-1b; UP1b; Tetraspanin-20; Tspan-20; Uroplakin Ib; UPIb |
|||||
| 3D Structure | ||||||
| Sequence |
MAKDNSTVRCFQGLLIFGNVIIGCCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAW
IGIFVGICLFCLSVLGIVGIMKSSRKILLAYFILMFIVYAFEVASCITAATQQDFFTPNL FLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENN DADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRHAWGVAWFGFAI LCWTFWVLLGTMFYWSRIEY |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Tetraspanin (TM4SF) family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C205(3.71); C218(2.08) | LDD3365 | [1] | |
Competitor(s) Related to This Target

