Details of the Target
General Information of Target
| Target ID | LDTP01325 | |||||
|---|---|---|---|---|---|---|
| Target Name | Krueppel-like factor 7 (KLF7) | |||||
| Gene Name | KLF7 | |||||
| Gene ID | 8609 | |||||
| Synonyms |
UKLF; Krueppel-like factor 7; Ubiquitous krueppel-like factor |
|||||
| 3D Structure | ||||||
| Sequence |
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR HI |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional factor. Plays a critical role in neuronal morphogenesis and survival of sensory neurons. Represses the corneal epithelium differentiation. Acts also as a metabolic regulator, by modulating insulin sensitivity in pancreatic beta cells and skeletal muscle cells. Inhibits transcriptional inducers of adipogenesis and has a repressive role in the expression of several adipokines, including leptin.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-465 Probe Info |
![]() |
K247(0.00); K250(0.00); Y249(0.00) | LDD2240 | [1] | |

