Details of the Target

General Information of Target

Target ID LDTP01310
Target Name GRB2-related adapter protein 2 (GRAP2)
Gene Name GRAP2
Gene ID 9402
Synonyms
GADS; GRB2L; GRID; GRB2-related adapter protein 2; Adapter protein GRID; GRB-2-like protein; GRB2L; GRBLG; GRBX; Grf40 adapter protein; Grf-40; Growth factor receptor-binding protein; Hematopoietic cell-associated adapter protein GrpL; P38; Protein GADS; SH3-SH2-SH3 adapter Mona
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Target Bioclass
Other
Family
GRB2/sem-5/DRK family
Subcellular location
Nucleus
Function Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc.
Uniprot ID
O75791
Ensemble ID
ENST00000344138.9
HGNC ID
HGNC:4563

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
SUDHL6 SNV: p.F122Y .
TE11 SNV: p.Q206H .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y324(10.74)  LDD0260  [1]
DBIA
 Probe Info  		C244(1.78)  LDD3397  [2]
IA-alkyne
 Probe Info  		N.A.  LDD2241  [3]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [3]
Compound 10
 Probe Info  		N.A.  LDD2216  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 HG-3 C244(2.12)  LDD2355  [2]
 LDCM0023  KB03 DEL C244(2.71)  LDD2732  [2]
 LDCM0024  KB05 PF-382 C244(1.78)  LDD3397  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
STAM-binding protein (STAMBP) Peptidase M67C family O95630
Phenazine biosynthesis-like domain-containing protein (PBLD) PhzF family P30039
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Mast/stem cell growth factor receptor Kit (KIT) Tyr protein kinase family P10721
Epidermal growth factor receptor (EGFR) Tyr protein kinase family P00533
Receptor tyrosine-protein kinase erbB-2 (ERBB2) Tyr protein kinase family P04626
Tyrosine-protein phosphatase non-receptor type 23 (PTPN23) Protein-tyrosine phosphatase family Q9H3S7
Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10) . O14672
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) Krueppel C2H2-type zinc-finger protein family Q9Y5A6
Zinc finger protein 319 (ZNF319) Krueppel C2H2-type zinc-finger protein family Q9P2F9
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
GRB2-associated-binding protein 2 (GAB2) GAB family Q9UQC2
GRB2-associated and regulator of MAPK protein 1 (GAREM1) GAREM family Q9H706
Protein sprouty homolog 2 (SPRY2) Sprouty family O43597
Keratinocyte proline-rich protein (KPRP) . Q5T749
Lymphocyte cytosolic protein 2 (LCP2) . Q13094
Proline-rich protein 35 (PRR35) . P0CG20
Ribonucleoprotein PTB-binding 1 (RAVER1) . Q8IY67
SH2 domain-containing protein 4A (SH2D4A) . Q9H788

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279