Details of the Target

General Information of Target

Target ID LDTP01260
Target Name DNA-directed RNA polymerase III subunit RPC9 (CRCP)
Gene Name CRCP
Gene ID 27297
Synonyms
DNA-directed RNA polymerase III subunit RPC9; RNA polymerase III subunit C9; Calcitonin gene-related peptide-receptor component protein; CGRP-RCP; CGRP-receptor component protein; CGRPRCP; HsC17
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRH
QSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTV
TSILPAEPEAEQKKNTNSNVAMDEEDPA
Target Bioclass
Enzyme
Family
Eukaryotic RPC9 RNA polymerase subunit family
Subcellular location
Nucleus
Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. With POLR3H/RPC8 forms a mobile stalk that protrudes from Pol III core and functions primarily in transcription initiation. Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway.; Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.
Uniprot ID
O75575
Ensemble ID
ENST00000338592.5
HGNC ID
HGNC:17888

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
IM95 SNV: p.I123T .
MFE319 SNV: p.E15A .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AMP probe
 Probe Info  		N.A.  LDD0200  [1]
ATP probe
 Probe Info  		N.A.  LDD0199  [1]
STPyne
 Probe Info  		N.A.  LDD0009  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Anterior gradient protein 2 homolog (AGR2) AGR family O95994
Zinc finger MIZ domain-containing protein 2 (ZMIZ2) . Q8NF64
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein goosecoid-2 (GSC2) Paired homeobox family O15499
Transcription factor 12 (TCF12) . Q99081
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Dynein light chain roadblock-type 1 (DYNLRB1) GAMAD family Q9NP97
Ligand-dependent nuclear receptor-interacting factor 1 (LRIF1) LRIF1 family Q5T3J3

References

1 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
2 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764