Details of the Target
General Information of Target
| Target ID | LDTP01176 | |||||
|---|---|---|---|---|---|---|
| Target Name | Semaphorin-7A (SEMA7A) |
|
||||
| Gene Name | SEMA7A | |||||
| Gene ID | 8482 | |||||
| Synonyms |
CD108; SEMAL; Semaphorin-7A; CDw108; JMH blood group antigen; John-Milton-Hargen human blood group Ag; Semaphorin-K1; Sema K1; Semaphorin-L; Sema L; CD antigen CD108 |
|||||
| 3D Structure | ||||||
| Sequence |
MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKG
HVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSC LDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLV LFEGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKI YYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNF NRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPN PRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVS SQWEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKE CPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFI ENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLT LGLLVH |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Family |
Semaphorin family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of pro-inflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K117(0.56); K123(5.56) | LDD0277 | [1] | |
|
BTD Probe Info |
 |
C266(1.42); C143(1.75) | LDD2107 | [2] | |
|
IPM Probe Info |
 |
C120(0.87) | LDD1701 | [2] | |
|
DBIA Probe Info |
 |
C566(0.99) | LDD0078 | [3] | |
|
Lodoacetamide azide Probe Info |
 |
C126(0.00); C143(0.00) | LDD0037 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0558 | 2-Cyano-N-phenylacetamide | MDA-MB-231 | C266(1.86); C120(1.00) | LDD2152 | [2] |
| LDCM0020 | ARS-1620 | HCC44 | C566(0.99) | LDD0078 | [3] |
| LDCM0022 | KB02 | CMK | C126(1.12); C566(2.48) | LDD2302 | [5] |
| LDCM0023 | KB03 | MDA-MB-231 | C120(0.87) | LDD1701 | [2] |
| LDCM0024 | KB05 | COLO792 | C126(0.85) | LDD3310 | [5] |
| LDCM0514 | Nucleophilic fragment 20a | MDA-MB-231 | C266(1.42); C143(1.75) | LDD2107 | [2] |
| LDCM0534 | Nucleophilic fragment 30a | MDA-MB-231 | C143(0.96) | LDD2127 | [2] |
| LDCM0535 | Nucleophilic fragment 30b | MDA-MB-231 | C120(0.48) | LDD2128 | [2] |
| LDCM0542 | Nucleophilic fragment 37 | MDA-MB-231 | C266(1.81) | LDD2135 | [2] |
| LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C266(1.53); C143(1.23) | LDD2136 | [2] |
| LDCM0544 | Nucleophilic fragment 39 | MDA-MB-231 | C266(1.45); C143(0.85) | LDD2137 | [2] |
| LDCM0546 | Nucleophilic fragment 40 | MDA-MB-231 | C266(0.88) | LDD2140 | [2] |
The Interaction Atlas With This Target
References