Details of the Target

General Information of Target

Target ID LDTP01111
Target Name Glycosaminoglycan xylosylkinase (FAM20B)
Gene Name FAM20B
Gene ID 9917
Synonyms
KIAA0475; Glycosaminoglycan xylosylkinase; EC 2.7.1.-; Xylose kinase
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTL
QSPWEIAAQWVVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKV
VFKPKRYSRDHVVEGEPYAGYDRHNAEVAAFHLDRILGFHRAPLVVGRFVNLRTEIKPVA
TEQLLSTFLTVGNNTCFYGKCYYCRETEPACADGDIMEGSVTLWLPDVWPLQKHRHPWGR
TYREGKLARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDE
GASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAH
DPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVEDRMPLSHL
Target Bioclass
Enzyme
Family
FAM20 family
Subcellular location
Golgi apparatus membrane
Function
Responsible for the 2-O-phosphorylation of xylose in the glycosaminoglycan-protein linkage region of proteoglycans thereby regulating the amount of mature GAG chains. Sulfated glycosaminoglycans (GAGs), including heparan sulfate and chondroitin sulfate, are synthesized on the so-called common GAG-protein linkage region (GlcUAbeta1-3Galbeta1-3Galbeta1-4Xylbeta1-O-Ser) of core proteins, which is formed by the stepwise addition of monosaccharide residues by the respective specific glycosyltransferases. Xylose 2-O-phosphorylation may influence the catalytic activity of B3GAT3 (GlcAT-I) which completes the precursor tetrasaccharide of GAG-protein linkage regions on which the repeating disaccharide region is synthesized.
Uniprot ID
O75063
Ensemble ID
ENST00000263733.5
HGNC ID
HGNC:23017

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Acrolein
 Probe Info  		H131(0.00); H408(0.00)  LDD0227  [1]
DBIA
 Probe Info  		C211(0.78)  LDD1571  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [3]
ATP probe
 Probe Info  		N.A.  LDD0035  [4]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0367  CL1 HEK-293T C211(0.78)  LDD1571  [2]
 LDCM0370  CL101 HEK-293T C211(0.95)  LDD1574  [2]
 LDCM0371  CL102 HEK-293T C211(1.07)  LDD1575  [2]
 LDCM0374  CL105 HEK-293T C211(0.72)  LDD1578  [2]
 LDCM0375  CL106 HEK-293T C211(0.78)  LDD1579  [2]
 LDCM0378  CL109 HEK-293T C211(0.80)  LDD1582  [2]
 LDCM0380  CL110 HEK-293T C211(0.92)  LDD1584  [2]
 LDCM0383  CL113 HEK-293T C211(0.99)  LDD1587  [2]
 LDCM0384  CL114 HEK-293T C211(0.91)  LDD1588  [2]
 LDCM0387  CL117 HEK-293T C211(0.88)  LDD1591  [2]
 LDCM0388  CL118 HEK-293T C211(0.79)  LDD1592  [2]
 LDCM0392  CL121 HEK-293T C211(0.89)  LDD1596  [2]
 LDCM0393  CL122 HEK-293T C211(0.73)  LDD1597  [2]
 LDCM0396  CL125 HEK-293T C211(0.72)  LDD1600  [2]
 LDCM0397  CL126 HEK-293T C211(1.02)  LDD1601  [2]
 LDCM0400  CL13 HEK-293T C211(0.92)  LDD1604  [2]
 LDCM0401  CL14 HEK-293T C211(1.13)  LDD1605  [2]
 LDCM0407  CL2 HEK-293T C211(0.96)  LDD1611  [2]
 LDCM0413  CL25 HEK-293T C211(1.37)  LDD1617  [2]
 LDCM0414  CL26 HEK-293T C211(0.89)  LDD1618  [2]
 LDCM0426  CL37 HEK-293T C211(1.04)  LDD1630  [2]
 LDCM0439  CL49 HEK-293T C211(0.95)  LDD1643  [2]
 LDCM0441  CL50 HEK-293T C211(1.24)  LDD1645  [2]
 LDCM0453  CL61 HEK-293T C211(0.81)  LDD1656  [2]
 LDCM0454  CL62 HEK-293T C211(0.91)  LDD1657  [2]
 LDCM0466  CL73 HEK-293T C211(0.85)  LDD1669  [2]
 LDCM0467  CL74 HEK-293T C211(0.94)  LDD1670  [2]
 LDCM0479  CL85 HEK-293T C211(1.04)  LDD1682  [2]
 LDCM0480  CL86 HEK-293T C211(1.06)  LDD1683  [2]
 LDCM0492  CL97 HEK-293T C211(0.89)  LDD1695  [2]
 LDCM0493  CL98 HEK-293T C211(0.81)  LDD1696  [2]
 LDCM0427  Fragment51 HEK-293T C211(1.11)  LDD1631  [2]
 LDCM0109  NEM HeLa H131(0.00); H408(0.00)  LDD0227  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Solute carrier family 7 member 14 (SLC7A14) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family Q8TBB6
G protein-activated inward rectifier potassium channel 2 (KCNJ6) Inward rectifier-type potassium channel family P48051
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Decorin (DCN) Small leucine-rich proteoglycan (SLRP) family P07585
Complex I assembly factor TIMMDC1, mitochondrial (TIMMDC1) Tim17/Tim22/Tim23 family Q9NPL8
Transmembrane protein 80 (TMEM80) . Q96HE8

References

1 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096