Details of the Target
General Information of Target
| Target ID | LDTP01079 | |||||
|---|---|---|---|---|---|---|
| Target Name | Receptor activity-modifying protein 3 (RAMP3) | |||||
| Gene Name | RAMP3 | |||||
| Gene ID | 10268 | |||||
| Synonyms |
Receptor activity-modifying protein 3; Calcitonin-receptor-like receptor activity-modifying protein 3; CRLR activity-modifying protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLS
EFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLI PLIVIPVVLTVAMAGLVVWRSKRTDTLL |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
RAMP family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

