Details of the Target
General Information of Target
Target ID | LDTP01079 | |||||
---|---|---|---|---|---|---|
Target Name | Receptor activity-modifying protein 3 (RAMP3) | |||||
Gene Name | RAMP3 | |||||
Gene ID | 10268 | |||||
Synonyms |
Receptor activity-modifying protein 3; Calcitonin-receptor-like receptor activity-modifying protein 3; CRLR activity-modifying protein 3 |
|||||
3D Structure | ||||||
Sequence |
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLS
EFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLI PLIVIPVVLTVAMAGLVVWRSKRTDTLL |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
RAMP family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] |