Details of the Target
General Information of Target
| Target ID | LDTP01077 | |||||
|---|---|---|---|---|---|---|
| Target Name | Receptor activity-modifying protein 1 (RAMP1) |
|
||||
| Gene Name | RAMP1 | |||||
| Gene ID | 10267 | |||||
| Synonyms |
Receptor activity-modifying protein 1; Calcitonin-receptor-like receptor activity-modifying protein 1; CRLR activity-modifying protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY PFIVVPITVTLLVTALVVWQSKRTEGIV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
RAMP family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C82(1.35) | LDD3430 | [1] | |
Competitor(s) Related to This Target