Details of the Target

General Information of Target

Target ID LDTP01070
Target Name SH2 domain-containing protein 1A (SH2D1A)
Gene Name SH2D1A
Gene ID 4068
Synonyms
DSHP; SAP; SH2 domain-containing protein 1A; Duncan disease SH2-protein; Signaling lymphocytic activation molecule-associated protein; SLAM-associated protein; T-cell signal transduction molecule SAP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTE
TGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIRED
PDVCLKAP
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Cytoplasmic adapter regulating receptors of the signaling lymphocytic activation molecule (SLAM) family such as SLAMF1, CD244, LY9, CD84, SLAMF6 and SLAMF7. In SLAM signaling seems to cooperate with SH2D1B/EAT-2. Initially it has been proposed that association with SLAMF1 prevents SLAMF1 binding to inhibitory effectors including INPP5D/SHIP1 and PTPN11/SHP-2. However, by simultaneous interactions, recruits FYN which subsequently phosphorylates and activates SLAMF1. Positively regulates CD244/2B4- and CD84-mediated natural killer (NK) cell functions. Can also promote CD48-, SLAMF6 -, LY9-, and SLAMF7-mediated NK cell activation. In the context of NK cell-mediated cytotoxicity enhances conjugate formation with target cells. May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.
Uniprot ID
O60880
Ensemble ID
ENST00000360027.5
HGNC ID
HGNC:10820
ChEMBL ID
CHEMBL2321636

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.A69T .
KYSE410 SNV: p.R55Q .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y100(8.01)  LDD0260  [1]
STPyne
 Probe Info  		K89(14.45)  LDD2219  [2]
DBIA
 Probe Info  		C124(1.19)  LDD3397  [3]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [4]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [4]
IPIAA_L
 Probe Info  		N.A.  LDD0031  [5]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [4]
Compound 10
 Probe Info  		N.A.  LDD2216  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 CMK C124(0.91)  LDD2302  [3]
 LDCM0023  KB03 Jurkat C124(1.17)  LDD2826  [3]
 LDCM0024  KB05 PF-382 C124(1.19)  LDD3397  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Activated CDC42 kinase 1 (TNK2) Tyr protein kinase family Q07912
Hepatocyte growth factor receptor (MET) Tyr protein kinase family P08581
Proto-oncogene tyrosine-protein kinase Src (SRC) Tyr protein kinase family P12931
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
T-cell surface glycoprotein CD3 zeta chain (CD247) CD3Z/FCER1G family P20963
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein c-Fos (FOS) BZIP family P01100
LIM/homeobox protein Lhx4 (LHX4) . Q969G2
Immunoglobulin
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Natural killer cell receptor 2B4 (CD244) . Q9BZW8
Signaling lymphocytic activation molecule (SLAMF1) . Q13291
SLAM family member 6 (SLAMF6) . Q96DU3
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Rho guanine nucleotide exchange factor 6 (ARHGEF6) . Q15052
Rho guanine nucleotide exchange factor 7 (ARHGEF7) . Q14155

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 Global profiling of lysine reactivity and ligandability in the human proteome. Nat Chem. 2017 Dec;9(12):1181-1190. doi: 10.1038/nchem.2826. Epub 2017 Jul 31.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
5 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
6 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279