Details of the Target
General Information of Target
| Target ID | LDTP01058 | |||||
|---|---|---|---|---|---|---|
| Target Name | P antigen family member 4 (PAGE4) | |||||
| Gene Name | PAGE4 | |||||
| Gene ID | 9506 | |||||
| Synonyms |
GAGEC1; P antigen family member 4; PAGE-4; G antigen family C member 1; PAGE-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVE
GDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GAGE family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Intrinsically disordered protein that potentiates the transcriptional activator activity of JUN. Protects cells from stress-induced apoptosis by inhibiting reactive oxygen species (ROS) production and via regulation of the MAPK signaling pathway.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C63(1.03) | LDD2297 | [1] | |
Competitor(s) Related to This Target