Details of the Target
General Information of Target
| Target ID | LDTP01022 | |||||
|---|---|---|---|---|---|---|
| Target Name | Immunoglobulin mu Fc receptor (FCMR) | |||||
| Gene Name | FCMR | |||||
| Gene ID | 9214 | |||||
| Synonyms |
FAIM3; TOSO; Immunoglobulin mu Fc receptor; IgM FcR; Fas apoptotic inhibitory molecule 3; FAIM3; Regulator of Fas-induced apoptosis Toso |
|||||
| 3D Structure | ||||||
| Sequence |
MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGT
VVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTL NVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSP TTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALD YGSQSGREGQGFHILIPTILGLFLLALLGLVVKRAVERRKALSRRARRLAVRMRALESSQ RPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVSESPWLHAPSL KTSCEYVSLYHQPAAMMEDSDSDDYINVPA |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Subcellular location |
Secreted; Membrane
|
|||||
| Function |
High-affinity Fc receptor for immunoglobulin M (IgM), both secreted and membrane-bound IgM. Primarily regulates IgM transport and homeostasis. Primarily regulates IgM transport and homeostasis. In lymphoid cells, enables exocytosis of membrane-bound IgM on the plasma membrane as well as endocytosis of IgM-antigen complexes toward lysosomes for degradation. In mucosal epithelium, mediates retrotranscytosis of antigen-IgM complexes across mucosal M cells toward antigen-presenting cells in mucosal lymphoid tissues. Triggers costimulatory signaling and mediates most of IgM effector functions involved in B cell development and primary immune response to infection. Likely limits tonic IgM BCR signaling to self-antigens for proper negative selection of autoreactive B cells in the bone marrow and for the maintenance of regulatory B cell pool in peripheral lymphoid organs. Mediates antibody responses to T cell-dependent and T cell-independent antigens and promotes induction of an efficient neutralizing IgG response. Engages in cross-talk with antigen-receptor signaling via the non-canonical NF-kappa-B, MAP kinases and calcium signaling pathways.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C318(7.31) | LDD1704 | [1] | |
|
DBIA Probe Info |
![]() |
C318(1.41) | LDD2171 | [2] | |
Competitor(s) Related to This Target
References


