Details of the Target
General Information of Target
| Target ID | LDTP01003 | |||||
|---|---|---|---|---|---|---|
| Target Name | Gremlin-1 (GREM1) |
|
||||
| Gene Name | GREM1 | |||||
| Gene ID | 26585 | |||||
| Synonyms |
CKTSF1B1; DAND2; DRM; Gremlin-1; Cell proliferation-inducing gene 2 protein; Cysteine knot superfamily 1, BMP antagonist 1; DAN domain family member 2; Down-regulated in Mos-transformed cells protein; Increased in high glucose protein 2; IHG-2
|
|||||
| 3D Structure | ||||||
| Sequence |
MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGR
GQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG QCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCIS IDLD |
|||||
| Target Type |
Patented-recorded
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
DAN family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner. Antagonist of BMP2; inhibits BMP2-mediated differentiation of osteoblasts (in vitro). Acts as inhibitor of monocyte chemotaxis. Can inhibit the growth or viability of normal cells but not transformed cells when is overexpressed.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C67(2.55) | LDD3318 | [1] | |
Competitor(s) Related to This Target