Details of the Target
General Information of Target
| Target ID | LDTP00908 | |||||
|---|---|---|---|---|---|---|
| Target Name | C-X-C motif chemokine 13 (CXCL13) |
|
||||
| Gene Name | CXCL13 | |||||
| Gene ID | 10563 | |||||
| Synonyms |
BCA1; BLC; SCYB13; C-X-C motif chemokine 13; Angie; B cell-attracting chemokine 1; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13 |
|||||
| 3D Structure | ||||||
| Sequence |
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Intercrine alpha (chemokine CxC) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C35(3.43); C60(3.91); C76(3.30) | LDD2268 | [1] | |
Competitor(s) Related to This Target