Details of the Target

General Information of Target

Target ID	LDTP00818
Target Name	Hypocretin neuropeptide precursor (HCRT)
Gene Name	HCRT
Gene ID	3060
Synonyms	OX; PPORX; PPOX; Hypocretin neuropeptide precursor; Hypocretin; Hcrt; Orexin precursor; Prepro-orexin; Preprohypocretin) [Cleaved into: Orexin-A; Hypocretin-1; Hcrt1; Orexin-B; Hypocretin-2; Hcrt2)]
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHA AGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAA ASVAPGGQSGI
Target Type	Literature-reported
Target Bioclass	Other
Family	Orexin family
Subcellular location	Rough endoplasmic reticulum
Function	Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested.; [Orexin-A]: Binds to orexin receptors HCRTR1/OX1R and HCRTR2/OX2R with a high affinity. Stimulates food intake. Modulates pituitary luteinizing hormone secretion in an ovarian steroid-dependent manner.; [Orexin-B]: Binds to orexin receptor HCRTR2/OX2R only. Stimulates food intake. Modulates pituitary luteinizing hormone secretion in an ovarian steroid-dependent manner.
TTD ID	T60744
Uniprot ID	O43612
DrugMap ID	TTU5HJP
Ensemble ID	ENST00000293330.1
HGNC ID	HGNC:4847

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
DBIA Probe Info			C410(1.62); C183(2.80)	LDD3312	[1]

PAL-AfBPP Probe

Click To Hide/Show 2 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
STS-1 Probe Info			N.A.	LDD0137	[2]
STS-2 Probe Info			N.A.	LDD0139	[2]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0022	KB02	22RV1	C26(1.45); C258(1.55)	LDD2243	[1]
LDCM0023	KB03	22RV1	C26(1.17); C258(1.69)	LDD2660	[1]
LDCM0024	KB05	HMCB	C410(1.62); C183(2.80)	LDD3312	[1]

The Interaction Atlas With This Target

The Drug(s) Related To This Target

Approved

Click To Hide/Show 1 Drug(s) Interacting with This Target

Drug Name				Drug Type	External ID
Pidolic Acid				Small molecular drug	DB03088

Investigative

Click To Hide/Show 1 Drug(s) Interacting with This Target

Drug Name				Drug Type	External ID
Pyroglutamic Acid				Small molecular drug	D0U7QA

References

1	DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22. Mass spectrometry data entry: PXD047840
2	Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.