Details of the Target
General Information of Target
| Target ID | LDTP00818 | |||||
|---|---|---|---|---|---|---|
| Target Name | Hypocretin neuropeptide precursor (HCRT) | |||||
| Gene Name | HCRT | |||||
| Gene ID | 3060 | |||||
| Synonyms |
OX; PPORX; PPOX; Hypocretin neuropeptide precursor; Hypocretin; Hcrt; Orexin precursor; Prepro-orexin; Preprohypocretin) [Cleaved into: Orexin-A; Hypocretin-1; Hcrt1; Orexin-B; Hypocretin-2; Hcrt2)] |
|||||
| 3D Structure | ||||||
| Sequence |
MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHA
AGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAA ASVAPGGQSGI |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Orexin family
|
|||||
| Subcellular location |
Rough endoplasmic reticulum
|
|||||
| Function |
Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested.; [Orexin-A]: Binds to orexin receptors HCRTR1/OX1R and HCRTR2/OX2R with a high affinity. Stimulates food intake. Modulates pituitary luteinizing hormone secretion in an ovarian steroid-dependent manner.; [Orexin-B]: Binds to orexin receptor HCRTR2/OX2R only. Stimulates food intake. Modulates pituitary luteinizing hormone secretion in an ovarian steroid-dependent manner.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C410(1.62); C183(2.80) | LDD3312 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
![]() |
N.A. | LDD0137 | [2] | |
|
STS-2 Probe Info |
![]() |
N.A. | LDD0139 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References



