General Information of Target

Target ID LDTP00807
Target Name Synaptotagmin-7 (SYT7)
Gene Name SYT7
Gene ID 9066
Synonyms
PCANAP7; Synaptotagmin-7; IPCA-7; Prostate cancer-associated protein 7; Synaptotagmin VII; SytVII
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPD
SGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSP
GSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLL
PDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSI
PLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGG
TSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDK
LSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA
Target Bioclass
Other
Family
Synaptotagmin family
Subcellular location
Cell membrane
Function
Ca(2+) sensor involved in Ca(2+)-dependent exocytosis of secretory and synaptic vesicles through Ca(2+) and phospholipid binding to the C2 domain. Ca(2+) induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis. SYT7 binds Ca(2+) with high affinity and slow kinetics compared to other synaptotagmins. Involved in Ca(2+)-triggered lysosomal exocytosis, a major component of the plasma membrane repair. Ca(2+)-regulated delivery of lysosomal membranes to the cell surface is also involved in the phagocytic uptake of particles by macrophages. Ca(2+)-triggered lysosomal exocytosis also plays a role in bone remodeling by regulating secretory pathways in osteoclasts and osteoblasts. In case of infection, involved in participates cell invasion by Trypanosoma cruzi via Ca(2+)-triggered lysosomal exocytosis. Involved in cholesterol transport from lysosome to peroxisome by promoting membrane contacts between lysosomes and peroxisomes: probably acts by promoting vesicle fusion by binding phosphatidylinositol-4,5-bisphosphate on peroxisomal membranes. Acts as a key mediator of synaptic facilitation, a process also named short-term synaptic potentiation: synaptic facilitation takes place at synapses with a low initial release probability and is caused by influx of Ca(2+) into the axon terminal after spike generation, increasing the release probability of neurotransmitters. Probably mediates synaptic facilitation by directly increasing the probability of release. May also contribute to synaptic facilitation by regulating synaptic vesicle replenishment, a process required to ensure that synaptic vesicles are ready for the arrival of the next action potential: SYT7 is required for synaptic vesicle replenishment by acting as a sensor for Ca(2+) and by forming a complex with calmodulin. Also acts as a regulator of Ca(2+)-dependent insulin and glucagon secretion in beta-cells. Triggers exocytosis by promoting fusion pore opening and fusion pore expansion in chromaffin cells. Also regulates the secretion of some non-synaptic secretory granules of specialized cells.
Uniprot ID
O43581
Ensemble ID
ENST00000263846.8
HGNC ID
HGNC:11514

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C543(1.84)  LDD3493  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0371  CL102 HEK-293T C275(0.79)  LDD1575  [2]
 LDCM0375  CL106 HEK-293T C275(0.85)  LDD1579  [2]
 LDCM0380  CL110 HEK-293T C275(0.99)  LDD1584  [2]
 LDCM0384  CL114 HEK-293T C275(0.98)  LDD1588  [2]
 LDCM0388  CL118 HEK-293T C275(0.98)  LDD1592  [2]
 LDCM0393  CL122 HEK-293T C275(0.68)  LDD1597  [2]
 LDCM0397  CL126 HEK-293T C275(0.83)  LDD1601  [2]
 LDCM0401  CL14 HEK-293T C275(0.86)  LDD1605  [2]
 LDCM0407  CL2 HEK-293T C275(1.08)  LDD1611  [2]
 LDCM0414  CL26 HEK-293T C275(0.77)  LDD1618  [2]
 LDCM0441  CL50 HEK-293T C275(0.87)  LDD1645  [2]
 LDCM0454  CL62 HEK-293T C275(1.00)  LDD1657  [2]
 LDCM0467  CL74 HEK-293T C275(0.74)  LDD1670  [2]
 LDCM0480  CL86 HEK-293T C275(0.84)  LDD1683  [2]
 LDCM0493  CL98 HEK-293T C275(0.61)  LDD1696  [2]
 LDCM0427  Fragment51 HEK-293T C275(0.96)  LDD1631  [2]
 LDCM0022  KB02 AU565 C543(1.55)  LDD2265  [1]
 LDCM0023  KB03 AU565 C543(1.80)  LDD2682  [1]
 LDCM0024  KB05 ZR-75-1 C543(1.84)  LDD3493  [1]

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402