Details of the Target

General Information of Target

Target ID LDTP00805
Target Name Carbonic anhydrase 12 (CA12)
Gene Name CA12
Gene ID 771
Synonyms
Carbonic anhydrase 12; EC 4.2.1.1; Carbonate dehydratase XII; Carbonic anhydrase XII; CA-XII; Tumor antigen HOM-RCC-3.1.3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Target Type
Successful
Target Bioclass
Enzyme
Family
Alpha-carbonic anhydrase family
Subcellular location
Membrane
Function Reversible hydration of carbon dioxide.
TTD ID
T16987
Uniprot ID
O43570
DrugMap ID
TTSYM0R
Ensemble ID
ENST00000178638.8
HGNC ID
HGNC:1371
ChEMBL ID
CHEMBL3242

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCK81 SNV: p.A345T .
FADU SNV: p.S266F .
HCT15 SNV: p.L257M .
HDQP1 SNV: p.S30C .
HEC1 SNV: p.W32L .
HG3 SNV: p.L167V .
K562 SNV: p.F274L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
OPA-S-S-alkyne
 Probe Info  		K279(2.86)  LDD3494  [1]
DBIA
 Probe Info  		C230(1.93)  LDD3310  [2]
IA-alkyne
 Probe Info  		C230(0.00); C259(0.00)  LDD0162  [3]
NAIA_5
 Probe Info  		C230(0.00); C259(0.00)  LDD2223  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 769-P C259(1.03)  LDD2246  [2]
 LDCM0023  KB03 42-MG-BA C259(1.15)  LDD2661  [2]
 LDCM0024  KB05 COLO792 C230(1.93)  LDD3310  [2]

The Interaction Atlas With This Target

The Drug(s) Related To This Target

Approved
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Acetazolamide Small molecular drug DB00819
Benzthiazide Small molecular drug DB00562
Hydroflumethiazide Small molecular drug DB00774
Salicyclic Acid Small molecular drug D07HBX
Sulfamylon Small molecular drug D0K1QD
Zonisamide Small molecular drug DB00909
Phase 3
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Curcumin Small molecular drug D07SDQ
Phenol Small molecular drug D0L6HN
Paraben . D0A8JP
Phase 2
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Coumate Small molecular drug D0Y6OA
Investigative
Click To Hide/Show 101 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
1,4-dihydro-1-methyl-4-oxo-3-pyridinesulfonamide Small molecular drug D05RAB
1-benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide Small molecular drug D04SNH
2,2,2-trifluoro-n-(4-sulfamoyl-phenyl)-acetamide Small molecular drug D0RK7J
2,2-dimethyl-n-(4-sulfamoyl-phenyl)-propionamide Small molecular drug D03DAM
2,3-dihydro-1h-indene-5-sulfonamide Small molecular drug D0LC0F
2,4-disulfamyltrifluoromethylaniline Small molecular drug D0M3PO
2-acetamido-2,3-dihydro-1h-indene-5-sulfonic Acid Small molecular drug D09TES
2-amino-2,3-dihydro-1h-indene-5-sulfonamide Small molecular drug D07CYN
2-amino-benzenesulfonamide Small molecular drug D0OI1H
2-hydrazinylbenzenesulfonamide Small molecular drug D0G0FJ
2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D0H3NS
2-oxo-2h-thiochromene-3-carboxylic Acid Small molecular drug D0D6UR
3-((4-aminophenyl)Diazenyl)Benzenesulfonamide Small molecular drug D0H4CF
3-((4-hydroxyphenyl)Diazenyl)Benzenesulfonamide Small molecular drug D0C7WG
3-(3-phenyl-ureido)-benzenesulfonamide Small molecular drug D06ZMH
3-(4'-hydroxyphenyl)Diazenylbenzenesulfonamide Small molecular drug D0BD0K
3-amino-benzenesulfonamide Small molecular drug D0J2AE
4,4'-thiodipyridine-3-sulfonamide Small molecular drug D03KRB
4-((4-hydroxyphenyl)Diazenyl)Benzenesulfonamide Small molecular drug D04HRS
4-(2-aminoethyl)Benzenesulfonamide Small molecular drug D04NSN
4-(2-methyl-8-quinolinoxy)-3-pyridinesulfonamide Small molecular drug D05ETN
4-(2-propynylthio)Pyridine-3-sulfonamide Small molecular drug D02BMV
4-(4'-n-methylphenyl)Diazenylbenzenesulfonamide Small molecular drug D00RDE
4-(4-cyanophenoxy)-3-pyridinesulfonamide Small molecular drug D05EBZ
4-(4-fluorophenoxy)-3-pyridinesulfonamide Small molecular drug D08JCC
4-(5-methyl-2-pirazolino)-3-pyridinesulfonamide Small molecular drug D0R4KQ
4-(Allylamino)-3-pyridinesulfonamide Small molecular drug D09TKG
4-(Carbamolymethylthio)Pyridine-3-sulfonamide Small molecular drug D0V5OW
4-(Cyanomethylthio)Pyridine-3-sulfonamide Small molecular drug D01OTW
4-(Hydroxymethyl)Benzenesulfonamide Small molecular drug D05XZM
4-(Methylhydrazino)-3-pyridinesulfonamide Small molecular drug D0Q5VB
4-(N-methyl-hydrazino)-benzenesulfonamide Small molecular drug D0M7VN
4-(N-oxide-2-pyridylthio)Pyridine-3-sulfonamide Small molecular drug D02NQK
4-(Quinolinoxy)-3-pyridinesulfonamide Small molecular drug D05JAJ
4-amino-3-chloro-benzenesulfonamide Small molecular drug D0YU8J
4-benzenesulfonylamino-benzenesulfonamide Small molecular drug D0YD9F
4-benzythiopyridine-3-sulfonamide Small molecular drug D06IOI
4-cyanophenol Small molecular drug D00IUB
4-ethoxy-3-pyridinesulfonamide Small molecular drug D04VSP
4-hydrazino-3-pyridinesulfonamide Small molecular drug D0UM1I
4-hydrazino-benzenesulfonamide Small molecular drug D0NN3Q
4-methanesulfonylamino-benzenesulfonamide Small molecular drug D00NUK
4-methoxy-3-pyridinesulfonamide Small molecular drug D00IKQ
4-methylamino-benzenesulfonamide Small molecular drug D07AGM
4-methylthiopyridine-3-sulfonamide Small molecular drug D0J7GU
4-[2-(3-phenyl-ureido)-ethyl]-benzenesulfonamide Small molecular drug D09LUD
6-(Aminomethyl)-2h-chromen-2-one Small molecular drug D0N1AW
6-(Hydroxymethyl)-2h-chromen-2-one Small molecular drug D0L5TZ
6-methoxy-2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D00XJA
6-methyl-2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D0G3BI
7-(Benzyloxy)-2h-chromen-2-one Small molecular drug D00RNZ
7-butoxy-2h-chromen-2-one Small molecular drug D0LU4S
7-methoxy-2-oxo-2h-chromene-4-carboxylic Acid Small molecular drug D0RB0D
7-phenethoxy-2h-chromen-2-one Small molecular drug D05QUG
7-propoxy-2h-chromen-2-one Small molecular drug D0OT5L
8-methoxy-2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D06DYP
Acetylsulfanilamide Small molecular drug D04POB
Benzolamide Small molecular drug D0E8CC
Carzenide Small molecular drug D09PWX
Catechin Small molecular drug D0V7AA
Catechol Small molecular drug D07QJJ
Cl-5343 Small molecular drug D0VD7H
Coumarin Small molecular drug D03ZMQ
Decane-1,10-diyl Disulfamate Small molecular drug D00YEF
Decyl Sulfamate Small molecular drug D09WSJ
Ellagic Acid Small molecular drug D0A1CM
Ellagic Acid Small molecular drug DB08846
Ethoxycoumarin Small molecular drug D05VSK
Ethyl 7-methoxy-2-oxo-2h-chromene-3-carboxylate Small molecular drug D07TAJ
Gallicacid Small molecular drug D0Y3TZ
Herniarin Small molecular drug D0U4BB
Hexane-1,6-diamine Small molecular drug D09JPC
N-(4-cyanophenyl)Sulfamide Small molecular drug D0M4EV
N-(4-sulfamoyl-phenyl)-benzamide Small molecular drug D0KB6T
N-(4-sulfamoyl-phenyl)-butyramide Small molecular drug D0K3LN
N-(4-sulfamoyl-phenyl)-isobutyramide Small molecular drug D0T2YZ
N-(4-sulfamoyl-phenyl)-propionamide Small molecular drug D0N8LR
N-(Pentafluorophenyl)Sulfamide Small molecular drug D0PA5L
N-hydroxysulfamide Small molecular drug D09CXX
N-propynyl Amidebenzenesulphonide Small molecular drug D01XFH
N1-(2-aminoethyl)Ethane-1,2-diamine Small molecular drug D09WVV
N1-(Naphthalen-1-yl)Ethane-1,2-diamine Small molecular drug D0X5HL
Octane-1,8-diyl Disulfamate Small molecular drug D0D4OV
Octyl Sulfamate Small molecular drug D05TLB
P-coumaric Acid Small molecular drug D0AU0M
P-toluenesulfonamide Small molecular drug D0ZC3W
Pentane-1,5-diamine Small molecular drug D02QGI
Pentanoic Acid (4-sulfamoyl-phenyl)-amide Small molecular drug D0Q0XO
Prop-2-ynyl 4-sulfamoylbenzoate Small molecular drug D00IAE
Resorcinol Small molecular drug D02DBP
Saccharin Small molecular drug D0A0YX
Sodium N-methylphenylaminomethanesulfonate Small molecular drug D0M9IQ
Sodium Phenylaminomethanesulfonate Small molecular drug D07UCQ
Syringic Acid Small molecular drug D0Q7DJ
2-amino-indan-5-sulfonic Acid . D0C4QB
4-(2-hydroxy-ethyl)-benzenesulfonamide . D04VLI
4-amino-3-bromo-benzenesulfonamide . D0P6AM
4-amino-3-fluoro-benzenesulfonamide . D04CVC
4-amino-3-iodo-benzenesulfonamide . D01STY
6-hydroxy-benzothiazole-2-sulfonic Acid Amide . D0Q2LL
Thioureido Sulfonamide . D0I0RT
Patented
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ferulic Acid Small molecular drug D03SLR

References

1 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264