Details of the Target

General Information of Target

Target ID LDTP00801
Target Name Fibroblast growth factor receptor substrate 3 (FRS3)
Gene Name FRS3
Gene ID 10817
Synonyms
Fibroblast growth factor receptor substrate 3; FGFR substrate 3; FGFR-signaling adaptor SNT2; Suc1-associated neurotrophic factor target 2; SNT-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIIT
RNSHPAELDLPRAPQPPNALGYTVSSFSNGCPGEGPRFSAPRRLSTSSLRHPSLGEESTH
ALIAPDEQSHTYVNTPASEDDHRRGRHCLQPLPEGQAPFLPQARGPDQRDPQVFLQPGQV
KFVLGPTPARRHMVKCQGLCPSLHDPPHHNNNNEAPSECPAQPKCTYENVTGGLWRGAGW
RLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGF
PDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQV
ELKGWGGDRPKGPQNPSSPQAPMPTTHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGTA
RKTRHNSTDLPL
Target Bioclass
Other
Subcellular location
Membrane
Function
Adapter protein that links FGF and NGF receptors to downstream signaling pathways. Involved in the activation of MAP kinases. Down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.
Uniprot ID
O43559
Ensemble ID
ENST00000259748.6
HGNC ID
HGNC:16970

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C80(2.93)  LDD3311  [1]
m-APA
 Probe Info  		N.A.  LDD2231  [2]
IPM
 Probe Info  		N.A.  LDD2156  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 BRX211 C80(2.23)  LDD2268  [1]
 LDCM0023  KB03 BRX211 C80(2.96)  LDD2685  [1]
 LDCM0024  KB05 G361 C80(2.93)  LDD3311  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Putative histone-lysine N-methyltransferase PRDM6 (PRDM6) Class V-like SAM-binding methyltransferase superfamily Q9NQX0
COP9 signalosome complex subunit 3 (COPS3) CSN3 family Q9UNS2
Glutamine-dependent NAD(+) synthetase (NADSYN1) NAD synthetase family Q6IA69
Mitochondrial inner membrane protease ATP23 homolog (ATP23) Peptidase M76 family Q9Y6H3
Phospholipid scramblase 1 (PLSCR1) Phospholipid scramblase family O15162
Serine/threonine-protein kinase 16 (STK16) Ser/Thr protein kinase family O75716
TNF receptor-associated factor 4 (TRAF4) TNF receptor-associated factor family Q9BUZ4
Protein-glutamine gamma-glutamyltransferase Z (TGM7) Transglutaminase family Q96PF1
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
CCN family member 3 (CCN3) CCN family P48745
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger and SCAN domain-containing protein 30 (ZSCAN30) Krueppel C2H2-type zinc-finger protein family Q86W11
Zinc finger protein 124 (ZNF124) Krueppel C2H2-type zinc-finger protein family Q15973
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 438 (ZNF438) Krueppel C2H2-type zinc-finger protein family Q7Z4V0
Zinc finger protein 552 (ZNF552) Krueppel C2H2-type zinc-finger protein family Q9H707
Zinc finger protein 90 homolog (ZFP90) Krueppel C2H2-type zinc-finger protein family Q8TF47
DNA-binding protein RFX6 (RFX6) RFX family Q8HWS3
DNA-binding protein inhibitor ID-2 (ID2) . Q02363
DNA-binding protein inhibitor ID-3 (ID3) . Q02535
Erythroid transcription factor (GATA1) . P15976
Golgin-45 (BLZF1) . Q9H2G9
Transcription factor 4 (TCF4) . P15884
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 (LINGO1) . Q96FE5
Other
Click To Hide/Show 50 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Cysteine-rich DPF motif domain-containing protein 1 (CDPF1) CDPF1 family Q6NVV7
Cilia- and flagella-associated protein 68 (CFAP68) CFAP68 family Q9H5F2
Protein chibby homolog 2 (CBY2) Chibby family Q8NA61
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Protein INCA1 (INCA1) INCA family Q0VD86
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type II cytoskeletal 2 oral (KRT76) Intermediate filament family Q01546
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 3-1 (KRTAP3-1) KRTAP type 3 family Q9BYR8
Keratin-associated protein 3-2 (KRTAP3-2) KRTAP type 3 family Q9BYR7
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Plasmolipin (PLLP) MAL family Q9Y342
Methyl-CpG-binding domain protein 3-like 1 (MBD3L1) MBD3L family Q8WWY6
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3) PI3K p85 subunit family Q92569
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Keratin-associated protein 11-1 (KRTAP11-1) PMG family Q8IUC1
RIMS-binding protein 3A (RIMBP3) RIMBP family Q9UFD9
SLAIN motif-containing protein 1 (SLAIN1) SLAIN motif-containing family Q8ND83
Protein sprouty homolog 2 (SPRY2) Sprouty family O43597
T-complex protein 10A homolog 1 (TCP10L) TCP10 family Q8TDR4
Tetraspanin-4 (TSPAN4) Tetraspanin (TM4SF) family O14817
Synaptic plasticity regulator PANTS (C22orf39) UPF0545 family Q6P5X5
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
WD repeat domain-containing protein 83 (WDR83) WD repeat MORG1 family Q9BRX9
Thyroid receptor-interacting protein 6 (TRIP6) Zyxin/ajuba family Q15654
Ankyrin repeat domain-containing protein 55 (ANKRD55) . Q3KP44
Collagen alpha-1(VIII) chain (COL8A1) . P27658
Doublecortin domain-containing protein 2B (DCDC2B) . A2VCK2
DPEP2 neighbor protein (DPEP2NB) . A0A0U1RQF7
Endothelial cell-specific molecule 1 (ESM1) . Q9NQ30
Extracellular matrix protein 1 (ECM1) . Q16610
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
KATNB1-like protein 1 (KATNBL1) . Q9H079
Keratinocyte proline-rich protein (KPRP) . Q5T749
Leucine-rich repeat-containing protein 18 (LRRC18) . Q8N456
Migration and invasion-inhibitory protein (MIIP) . Q5JXC2
PDZ and LIM domain protein 7 (PDLIM7) . Q9NR12
Saitohin (STH) . Q8IWL8
Spermatogenesis-associated protein 12 (SPATA12) . Q7Z6I5
Suppressor of cytokine signaling 4 (SOCS4) . Q8WXH5
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Uncharacterized protein KCNJ5-AS1 (KCNJ5-AS1) . Q8TAV5
Uncharacterized protein KIAA0408 (KIAA0408) . Q6ZU52

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
3 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019