Details of the Target
General Information of Target
| Target ID | LDTP00740 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) | |||||
| Gene Name | ZSCAN12 | |||||
| Gene ID | 9753 | |||||
| Synonyms |
KIAA0426; ZNF305; ZNF96; Zinc finger and SCAN domain-containing protein 12; Zinc finger protein 305; Zinc finger protein 96 |
|||||
| 3D Structure | ||||||
| Sequence |
MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGP
REALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTV LEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQ EQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSARCGETREPEEITEEPSACS REDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGKAFSQHSHLIEHQRIHTGDR PYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHC NDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECG KAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQ RTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSL IQHQRIHTGEKPYQCDECGKAFRQRSDLSKHQRIHNRRGTYVCKECGKSFRQNSALTQHQ TIHKGEKSVSV |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
H375(0.00); H376(0.00) | LDD0232 | [1] | |
|
DBIA Probe Info |
![]() |
C239(1.24) | LDD1492 | [2] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [3] | |
|
HHS-465 Probe Info |
![]() |
K328(0.00); K331(0.00); Y330(0.00) | LDD2240 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0371 | CL102 | HEK-293T | C53(0.72) | LDD1575 | [2] |
| LDCM0375 | CL106 | HEK-293T | C53(1.10) | LDD1579 | [2] |
| LDCM0380 | CL110 | HEK-293T | C53(0.92) | LDD1584 | [2] |
| LDCM0384 | CL114 | HEK-293T | C53(0.77) | LDD1588 | [2] |
| LDCM0388 | CL118 | HEK-293T | C53(0.90) | LDD1592 | [2] |
| LDCM0393 | CL122 | HEK-293T | C53(0.85) | LDD1597 | [2] |
| LDCM0397 | CL126 | HEK-293T | C53(1.44) | LDD1601 | [2] |
| LDCM0401 | CL14 | HEK-293T | C53(0.83) | LDD1605 | [2] |
| LDCM0407 | CL2 | HEK-293T | C53(1.16) | LDD1611 | [2] |
| LDCM0414 | CL26 | HEK-293T | C53(0.68) | LDD1618 | [2] |
| LDCM0441 | CL50 | HEK-293T | C53(1.26) | LDD1645 | [2] |
| LDCM0454 | CL62 | HEK-293T | C53(1.01) | LDD1657 | [2] |
| LDCM0467 | CL74 | HEK-293T | C53(0.90) | LDD1670 | [2] |
| LDCM0480 | CL86 | HEK-293T | C53(1.02) | LDD1683 | [2] |
| LDCM0493 | CL98 | HEK-293T | C53(1.15) | LDD1696 | [2] |
| LDCM0427 | Fragment51 | HEK-293T | C53(1.24) | LDD1631 | [2] |
| LDCM0022 | KB02 | HEK-293T | C239(1.24) | LDD1492 | [2] |
| LDCM0023 | KB03 | HEK-293T | C239(1.46) | LDD1497 | [2] |
| LDCM0024 | KB05 | HEK-293T | C239(0.79) | LDD1502 | [2] |
| LDCM0109 | NEM | HeLa | H375(0.00); H376(0.00) | LDD0232 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| SRSF protein kinase 2 (SRPK2) | CMGC Ser/Thr protein kinase family | P78362 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Vacuolar protein sorting-associated protein 26A (VPS26A) | VPS26 family | O75436 | |||
| Small ribosomal subunit protein RACK1 (RACK1) | WD repeat G protein beta family | P63244 | |||
Transcription factor
Other
References




