Details of the Target

General Information of Target

Target ID LDTP00740
Target Name Zinc finger and SCAN domain-containing protein 12 (ZSCAN12)
Gene Name ZSCAN12
Gene ID 9753
Synonyms
KIAA0426; ZNF305; ZNF96; Zinc finger and SCAN domain-containing protein 12; Zinc finger protein 305; Zinc finger protein 96
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGP
REALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTV
LEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQ
EQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSARCGETREPEEITEEPSACS
REDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGKAFSQHSHLIEHQRIHTGDR
PYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHC
NDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSILTQHQGVHTGAKPYECNECG
KAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQ
RTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSL
IQHQRIHTGEKPYQCDECGKAFRQRSDLSKHQRIHNRRGTYVCKECGKSFRQNSALTQHQ
TIHKGEKSVSV
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function May be involved in transcriptional regulation.
Uniprot ID
O43309
Ensemble ID
ENST00000361028.5
HGNC ID
HGNC:13172

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
DU145 SNV: p.E494Q .
IM95 Deletion: p.A477PfsTer149 .
MCC13 SNV: p.H375Y .
MFE319 SNV: p.P413S .
MOLT4 SNV: p.H264Y .
NALM6 SNV: p.Q47R .
NB1 SNV: p.V44F .
NCIH1155 SNV: p.A477T .
OVK18 SNV: p.K504R .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Acrolein
 Probe Info  		H375(0.00); H376(0.00)  LDD0232  [1]
DBIA
 Probe Info  		C239(1.24)  LDD1492  [2]
TFBX
 Probe Info  		N.A.  LDD0027  [3]
HHS-465
 Probe Info  		K328(0.00); K331(0.00); Y330(0.00)  LDD2240  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0371  CL102 HEK-293T C53(0.72)  LDD1575  [2]
 LDCM0375  CL106 HEK-293T C53(1.10)  LDD1579  [2]
 LDCM0380  CL110 HEK-293T C53(0.92)  LDD1584  [2]
 LDCM0384  CL114 HEK-293T C53(0.77)  LDD1588  [2]
 LDCM0388  CL118 HEK-293T C53(0.90)  LDD1592  [2]
 LDCM0393  CL122 HEK-293T C53(0.85)  LDD1597  [2]
 LDCM0397  CL126 HEK-293T C53(1.44)  LDD1601  [2]
 LDCM0401  CL14 HEK-293T C53(0.83)  LDD1605  [2]
 LDCM0407  CL2 HEK-293T C53(1.16)  LDD1611  [2]
 LDCM0414  CL26 HEK-293T C53(0.68)  LDD1618  [2]
 LDCM0441  CL50 HEK-293T C53(1.26)  LDD1645  [2]
 LDCM0454  CL62 HEK-293T C53(1.01)  LDD1657  [2]
 LDCM0467  CL74 HEK-293T C53(0.90)  LDD1670  [2]
 LDCM0480  CL86 HEK-293T C53(1.02)  LDD1683  [2]
 LDCM0493  CL98 HEK-293T C53(1.15)  LDD1696  [2]
 LDCM0427  Fragment51 HEK-293T C53(1.24)  LDD1631  [2]
 LDCM0022  KB02 HEK-293T C239(1.24)  LDD1492  [2]
 LDCM0023  KB03 HEK-293T C239(1.46)  LDD1497  [2]
 LDCM0024  KB05 HEK-293T C239(0.79)  LDD1502  [2]
 LDCM0109  NEM HeLa H375(0.00); H376(0.00)  LDD0232  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SRSF protein kinase 2 (SRPK2) CMGC Ser/Thr protein kinase family P78362
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Vacuolar protein sorting-associated protein 26A (VPS26A) VPS26 family O75436
Small ribosomal subunit protein RACK1 (RACK1) WD repeat G protein beta family P63244
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) Krueppel C2H2-type zinc-finger protein family Q9Y5A6
Zinc finger and SCAN domain-containing protein 32 (ZSCAN32) Krueppel C2H2-type zinc-finger protein family Q9NX65
Zinc finger protein 24 (ZNF24) Krueppel C2H2-type zinc-finger protein family P17028
Zinc finger protein 473 (ZNF473) Krueppel C2H2-type zinc-finger protein family Q8WTR7
Zinc finger protein 496 (ZNF496) Krueppel C2H2-type zinc-finger protein family Q96IT1
Zinc finger protein with KRAB and SCAN domains 7 (ZKSCAN7) Krueppel C2H2-type zinc-finger protein family Q9P0L1
Other
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Centromere protein H (CENPH) CENP-H/MCM16 family Q9H3R5
Protein FAM161A (FAM161A) FAM161 family Q3B820
Prelamin-A/C (LMNA) Intermediate filament family P02545
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
PiggyBac transposable element-derived protein 1 (PGBD1) . Q96JS3
SCAN domain-containing protein 1 (SCAND1) . P57086
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699

References

1 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
4 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010