Details of the Target
General Information of Target
| Target ID | LDTP00711 | |||||
|---|---|---|---|---|---|---|
| Target Name | Septin-4 (SEPTIN4) | |||||
| Gene Name | SEPTIN4 | |||||
| Gene ID | 5414 | |||||
| Synonyms |
C17orf47; PNUTL2; SEP4; SEPT4; Septin-4; Bradeion beta; Brain protein H5; CE5B3 beta; Cell division control-related protein 2; hCDCREL-2; Peanut-like protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQ
VPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSED DKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEE RIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDE SGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVD HKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRV RGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVV KERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
|
|||||
| Subcellular location |
Cytoplasm; Mitochondrion
|
|||||
| Function |
Filament-forming cytoskeletal GTPase (Probable). Pro-apoptotic protein involved in LGR5-positive intestinal stem cell and Paneth cell expansion in the intestines, via its interaction with XIAP. May also play a role in the regulation of cell fate in the intestine. Positive regulator of apoptosis involved in hematopoietic stem cell homeostasis; via its interaction with XIAP. Negative regulator of repair and hair follicle regeneration in response to injury, due to inhibition of hair follicle stem cell proliferation, potentially via its interaction with XIAP. Plays an important role in male fertility and sperm motility. During spermiogenesis, essential for the establishment of the annulus (a fibrous ring structure connecting the midpiece and the principal piece of the sperm flagellum) which is a requisite for the structural and mechanical integrity of the sperm. Involved in the migration of cortical neurons and the formation of neuron leading processes during embryonic development. Required for dopaminergic metabolism in presynaptic autoreceptors; potentially via activity as a presynaptic scaffold protein.; [Isoform ARTS]: Required for the induction of cell death mediated by TGF-beta and possibly by other apoptotic stimuli. Induces apoptosis through binding and inhibition of XIAP resulting in significant reduction in XIAP levels, leading to caspase activation and cell death. Mediates the interaction between BCL2 and XIAP, thereby positively regulating the ubiquitination and degradation of BCL2 and promoting apoptosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C426(1.65) | LDD3332 | [1] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2232 | [2] | |
Competitor(s) Related to This Target
References


