Details of the Target
General Information of Target
| Target ID | LDTP00679 | |||||
|---|---|---|---|---|---|---|
| Target Name | Claudin-3 (CLDN3) | |||||
| Gene Name | CLDN3 | |||||
| Gene ID | 1365 | |||||
| Synonyms |
C7orf1; CPETR2; Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate.1 protein homolog; hRVP1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Claudin family
|
|||||
| Subcellular location |
Cell junction, tight junction
|
|||||
| Function | Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y191(112.02); Y198(104.47) | LDD3495 | [1] | |

