Details of the Target
General Information of Target
| Target ID | LDTP00647 | |||||
|---|---|---|---|---|---|---|
| Target Name | C-C motif chemokine 16 (CCL16) |
|
||||
| Gene Name | CCL16 | |||||
| Gene ID | 6360 | |||||
| Synonyms |
ILINCK; NCC4; SCYA16; C-C motif chemokine 16; Chemokine CC-4; HCC-4; Chemokine LEC; IL-10-inducible chemokine; LCC-1; Liver-expressed chemokine; Lymphocyte and monocyte chemoattractant; LMC; Monotactin-1; MTN-1; NCC-4; Small-inducible cytokine A16
|
|||||
| 3D Structure | ||||||
| Sequence |
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNC
HLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Intercrine beta (chemokine CC) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
 |
C38(0.00); C37(0.00) | LDD2223 | [1] | |