Details of the Target
General Information of Target
| Target ID | LDTP00602 | |||||
|---|---|---|---|---|---|---|
| Target Name | Polyunsaturated fatty acid lipoxygenase ALOX15B (ALOX15B) | |||||
| Gene Name | ALOX15B | |||||
| Gene ID | 247 | |||||
| Synonyms |
Polyunsaturated fatty acid lipoxygenase ALOX15B; 15-lipoxygenase 2; 15-LOX-2; Arachidonate 15-lipoxygenase B; 15-LOX-B; EC 1.13.11.33; Arachidonate 15-lipoxygenase type II; Linoleate 13-lipoxygenase 15-LOb; EC 1.13.11.-
|
|||||
| 3D Structure | ||||||
| Sequence |
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL PYTYLDPPLIENSVSI |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Lipoxygenase family
|
|||||
| Subcellular location |
Nucleus; Cytoplasm, cytosol
|
|||||
| Function |
[Isoform A]: Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids (PUFAs) generating a spectrum of bioactive lipid mediators (Probable). It inserts peroxyl groups at C15 of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) producing (15S)-hydroperoxyeicosatetraenoate/(15S)-HPETE (Probable). Also peroxidizes linoleate ((9Z,12Z)-octadecadienoate) to 13-hydroperoxyoctadecadienoate/13-HPODE (Probable). Oxygenates arachidonyl derivatives such as 2-arachidonoylglycerol (2-AG) leading to the production and extracellular release of 15-hydroxyeicosatetraenoyl glycerol (15-HETE-G) that acts as a peroxisome proliferator-activated receptor alpha agonist. Has the ability to efficiently class-switch ALOX5 pro-inflammatory mediators into anti-inflammatory intermediates. Participates in the sequential oxidations of DHA ((4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate) to generate specialized pro-resolving mediators (SPMs) resolvin D5 ((7S,17S)-diHPDHA), which can actively down-regulate the immune response and have anti-aggregation properties with platelets. In addition to free PUFAs hydrolyzed from phospholipids, it directly oxidizes PUFAs esterified to membrane-bound phospholipids. Has no detectable 8S-lipoxygenase activity on arachidonate but reacts with (8S)-HPETE to produce (8S,15S)-diHPETE (Probable). May regulate progression through the cell cycle and cell proliferation. May also regulate cytokine secretion by macrophages and therefore play a role in the immune response. May also regulate macrophage differentiation into proatherogenic foam cells.; [Isoform B]: Does not convert arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid/(15S)-HPETE.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ONAyne Probe Info |
![]() |
K175(0.44) | LDD0274 | [1] | |
|
DBIA Probe Info |
![]() |
C395(1.56) | LDD2267 | [2] | |
|
CY-1 Probe Info |
![]() |
N.A. | LDD0246 | [3] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase TRAIP (TRAIP) | TRAIP family | Q9BWF2 | |||
| E3 ubiquitin-protein ligase TRIM21 (TRIM21) | TRIM/RBCC family | P19474 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Potassium voltage-gated channel subfamily F member 1 (KCNF1) | Potassium channel family | Q9H3M0 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Retinoic acid receptor alpha (RARA) | Nuclear hormone receptor family | P10276 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cancer/testis antigen 1 (CTAG1A; CTAG1B) | CTAG/PCC1 family | P78358 | |||
| Coiled-coil domain-containing protein 115 (CCDC115) | . | Q96NT0 | |||
References




