Details of the Target

General Information of Target

Target ID	LDTP00599
Target Name	Telethonin (TCAP)
Gene Name	TCAP
Gene ID	8557
Synonyms	Telethonin; Titin cap protein
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQVL VQRSPWLMMRMGILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEEREDTPIQLQELLALE TALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSMSQEAQRG
Target Bioclass	Other
Subcellular location	Cytoplasm, myofibril, sarcomere
Function	Muscle assembly regulating factor. Mediates the antiparallel assembly of titin (TTN) molecules at the sarcomeric Z-disk.
Uniprot ID	O15273
Ensemble ID	ENST00000309889.3
HGNC ID	HGNC:11610

Probe(s) Labeling This Target

PAL-AfBPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
STS-1 Probe Info			N.A.	LDD0137	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme

Click To Hide/Show 9 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Caspase-6 (CASP6)	Peptidase C14A family	P55212
Titin (TTN)	CAMK Ser/Thr protein kinase family	Q8WZ42
Serine/threonine-protein kinase PAK 1 (PAK1)	STE Ser/Thr protein kinase family	Q13153
Fibroblast growth factor receptor 3 (FGFR3)	Tyr protein kinase family	P22607
Ras-related protein Rab-5A (RAB5A)	Rab family	P20339
GTP-binding nuclear protein Ran (RAN)	Ran family	P62826
TNF receptor-associated factor 2 (TRAF2)	TNF receptor-associated factor family	Q12933
Coagulation factor XIII A chain (F13A1)	Transglutaminase family	P00488
Ubiquitin-conjugating enzyme E2 K (UBE2K)	Ubiquitin-conjugating enzyme family	P61086

Transporter and channel

Click To Hide/Show 4 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Glutamate receptor ionotropic, NMDA 2C (GRIN2C)	Glutamate-gated ion channel family	Q14957
Junctophilin-3 (JPH3)	Junctophilin family	Q8WXH2
Huntingtin-interacting protein 1 (HIP1)	SLA2 family	O00291
Alpha-crystallin A chain (CRYAA)	Small heat shock protein (HSP20) family	P02489

Transcription factor

Click To Hide/Show 3 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Zinc finger protein Aiolos (IKZF3)	Ikaros C2H2-type zinc-finger protein family	Q9UKT9
Krueppel-like factor 11 (KLF11)	Sp1 C2H2-type zinc-finger protein family	O14901
Golgin-45 (BLZF1)	.	Q9H2G9

Immunoglobulin

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Platelet endothelial cell adhesion molecule (PECAM1)				.	P16284

Other

Click To Hide/Show 14 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Ankyrin repeat and SOCS box protein 6 (ASB6)	Ankyrin SOCS box (ASB) family	Q9NWX5
Ataxin-1 (ATXN1)	ATXN1 family	P54253
Cytoplasmic dynein 1 heavy chain 1 (DYNC1H1)	Dynein heavy chain family	Q14204
Glial fibrillary acidic protein (GFAP)	Intermediate filament family	P14136
Vimentin (VIM)	Intermediate filament family	P08670
Keratin-associated protein 19-7 (KRTAP19-7)	KRTAP type 19 family	Q3SYF9
Myozenin-2 (MYOZ2)	Myozenin family	Q9NPC6
Tetratricopeptide repeat protein 19, mitochondrial (TTC19)	TTC19 family	Q6DKK2
Gelsolin (GSN)	Villin/gelsolin family	P06396
Cell division cycle-associated protein 4 (CDCA4)	.	Q9BXL8
Chromobox protein homolog 5 (CBX5)	.	P45973
Cysteine and glycine-rich protein 3 (CSRP3)	.	P50461
Pleckstrin homology domain-containing family F member 2 (PLEKHF2)	.	Q9H8W4
Ubiquilin-1 (UBQLN1)	.	Q9UMX0

References

1	Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.