Details of the Target
General Information of Target
Target ID | LDTP00485 | |||||
---|---|---|---|---|---|---|
Target Name | Transcription factor EC (TFEC) | |||||
Gene Name | TFEC | |||||
Gene ID | 22797 | |||||
Synonyms |
BHLHE34; TCFEC; TFECL; Transcription factor EC; TFE-C; Class E basic helix-loop-helix protein 34; bHLHe34; Transcription factor EC-like; hTFEC-L |
|||||
3D Structure | ||||||
Sequence |
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWH
MEDVIEDIIGMESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL PMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGT ILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGT VDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALKE EQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL |
|||||
Target Bioclass |
Transcription factor
|
|||||
Family |
MiT/TFE family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Transcriptional regulator that acts as a repressor or an activator. Acts as a transcriptional repressor on minimal promoter containing element F (that includes an E-box sequence). Binds to element F in an E-box sequence-specific manner. Acts as a transcriptional transactivator on the proximal promoter region of the tartrate-resistant acid phosphatase (TRAP) E-box containing promoter. Collaborates with MITF in target gene activation. Acts as a transcriptional repressor on minimal promoter containing mu E3 enhancer sequence. Binds to mu E3 DNA sequence of the immunoglobulin heavy-chain gene enhancer. Binds DNA in a homo- or heterodimeric form.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K178(9.09) | LDD0277 | [1] |