Details of the Target
General Information of Target
| Target ID | LDTP00471 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tax1-binding protein 3 (TAX1BP3) | |||||
| Gene Name | TAX1BP3 | |||||
| Gene ID | 30851 | |||||
| Synonyms |
TIP1; Tax1-binding protein 3; Glutaminase-interacting protein 3; Tax interaction protein 1; TIP-1; Tax-interacting protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV
SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ SMLS |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K20(10.00) | LDD0277 | [1] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [2] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [2] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [3] | |
The Interaction Atlas With This Target
References




