Details of the Target
General Information of Target
| Target ID | LDTP00466 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane 4 L6 family member 5 (TM4SF5) | |||||
| Gene Name | TM4SF5 | |||||
| Gene ID | 9032 | |||||
| Synonyms |
Transmembrane 4 L6 family member 5; Tetraspan transmembrane protein L6H |
|||||
| 3D Structure | ||||||
| Sequence |
MCTGKCARCVGLSLITLCLVCIVANALLLVPNGETSWTNTNHLSLQVWLMGGFIGGGLMV
LCPGIAAVRAGGKGCCGAGCCGNRCRMLRSVFSSAFGVLGAIYCLSVSGAGLRNGPRCLM NGEWGYHFEDTAGAYLLNRTLWDRCEAPPRVVPWNVTLFSLLVAASCLEIVLCGIQLVNA TIGVFCGDCRKKQDTPH |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
L6 tetraspanin family
|
|||||
| Subcellular location |
Lysosome membrane
|
|||||
| Function |
Acts as a lysosomal membrane arginine sensor. Forms a complex with MTOR and SLC38A9 on lysosomal membranes in an arginine-regulated manner, leading to arginine efflux which enables the activation of mTORC1 which subsequently leads to RPS6KB1 and EIF4EBP1 phosphorylations. Facilitates cell cycle G1/S phase progression and the translocation of the CDK4-CCND1 complex into the nucleus. CDKN1B and RHOA/ROCK signaling activity are involved in TM4SF5-mediated acceleration of G1/S phase progression.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C145(5.37) | LDD3380 | [1] | |
Competitor(s) Related to This Target