Details of the Target
General Information of Target
| Target ID | LDTP00457 | |||||
|---|---|---|---|---|---|---|
| Target Name | Free fatty acid receptor 1 (FFAR1) | |||||
| Gene Name | FFAR1 | |||||
| Gene ID | 2864 | |||||
| Synonyms |
GPR40; Free fatty acid receptor 1; G-protein coupled receptor 40 |
|||||
| 3D Structure | ||||||
| Sequence |
MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
G-protein coupled receptor for medium and long chain saturated and unsaturated fatty acids that plays an important role in glucose homeostasis. Fatty acid binding increases glucose-stimulated insulin secretion, and may also enhance the secretion of glucagon-like peptide 1 (GLP-1). May also play a role in bone homeostasis; receptor signaling activates pathways that inhibit osteoclast differentiation. Ligand binding leads to a conformation change that triggers signaling via G-proteins that activate phospholipase C, leading to an increase of the intracellular calcium concentration. Seems to act through a G(q) and G(i)-mediated pathway. Mediates the anti-inflammatory effects of omega-3 polyunsaturated fatty acids (PUFAs) via inhibition of NLRP3 inflammasome activation.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C289(3.42) | LDD2229 | [1] | |
|
BTD Probe Info |
![]() |
C289(0.95) | LDD2143 | [2] | |
Competitor(s) Related to This Target
References


