Details of the Target
General Information of Target
| Target ID | LDTP00441 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) |
|
||||
| Gene Name | TNFRSF10C | |||||
| Gene ID | 8794 | |||||
| Synonyms |
DCR1; LIT; TRAILR3; TRID; Tumor necrosis factor receptor superfamily member 10C; Antagonist decoy receptor for TRAIL/Apo-2L; Decoy TRAIL receptor without death domain; Decoy receptor 1; DcR1; Lymphocyte inhibitor of TRAIL; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; TRAIL receptor without an intracellular domain; CD antigen CD263
|
|||||
| 3D Structure | ||||||
| Sequence |
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHY LSCTIVGIIVLIVLLIVFV |
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C53(1.48) | LDD3346 | [1] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [2] | |
Competitor(s) Related to This Target
References