Details of the Target
General Information of Target
| Target ID | LDTP00388 | |||||
|---|---|---|---|---|---|---|
| Target Name | Late cornified envelope protein 2B (LCE2B) | |||||
| Gene Name | LCE2B | |||||
| Gene ID | 26239 | |||||
| Synonyms |
LEP10; SPRL1B; XP5; Late cornified envelope protein 2B; Late envelope protein 10; Skin-specific protein Xp5; Small proline-rich-like epidermal differentiation complex protein 1B |
|||||
| 3D Structure | ||||||
| Sequence |
MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSS
GGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
LCE family
|
|||||
| Function | Precursors of the cornified envelope of the stratum corneum. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
 |
C20(1.91) | LDD2120 | [1] | |
Competitor(s) Related to This Target